DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and tmprss6

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_004913946.2 Gene:tmprss6 / 100489045 XenbaseID:XB-GENE-1011573 Length:806 Species:Xenopus tropicalis


Alignment Length:251 Identity:90/251 - (35%)
Similarity:141/251 - (56%) Gaps:30/251 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RIINGTEASLGATRHQVGIRKALNDGYFFGTGHLCGGSLIRPGWVLTAAHCFVDQIIYDGTFVPK 109
            |::.||:|..|....|..::        ....|:|||:|:...|:|||||||..:     ::...
 Frog   570 RLVGGTQAQEGEWPWQASLQ--------VRGEHICGGTLVADQWILTAAHCFTPE-----SYASP 621

  Fly   110 EEFIVVMGNLDRYNRT--NTLTFTIEERIMQLDKFDLSTYDKDIALLMLNGTVPTGHPTIRPIAL 172
            |.:.|.:|.: |.:|:  ..|.|.: .|::....:|..::|.|:||::|:..||...|.::||.|
 Frog   622 EVWTVYLGKV-RLSRSTQKELAFKV-IRLVIHPFYDEDSHDYDVALVLLDHLVPLTSPHVQPICL 684

  Fly   173 --NRFAIPEGVVCQVTGWGNT-EDGYVSDILMTVDVPMISEEHCINDSDL-GHLIQPGMICAGYL 233
              :....|.|..|.|||||:. |:|..||:|..||:.:::::.|   ::| .:.|.|.|:||||.
 Frog   685 PSSTHHFPTGSSCWVTGWGSVKENGPTSDVLQKVDIQLVAQDIC---TELYRYQISPRMLCAGYR 746

  Fly   234 EVGEKDACAGDSGGPLVCQSE-----LAGVVSWGIQCALPRLPGVYTEVSYYYDWI 284
            : |.||||.||||.||||::.     .||:||||..|.:||..|||:.::....||
 Frog   747 D-GSKDACQGDSGSPLVCKTASGRWFQAGLVSWGAGCGIPRYFGVYSRITRLVQWI 801

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 88/249 (35%)
tmprss6XP_004913946.2 SEA 77..176 CDD:396113
CUB 235..303 CDD:412131
LDLa 448..478 CDD:238060
LDLa 480..514 CDD:238060
LDLa 525..560 CDD:238060
Tryp_SPc 572..804 CDD:238113 89/249 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.