DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and LOC100485347

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_002941066.3 Gene:LOC100485347 / 100485347 -ID:- Length:255 Species:Xenopus tropicalis


Alignment Length:289 Identity:100/289 - (34%)
Similarity:135/289 - (46%) Gaps:49/289 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLAVALLLIFLPSGLRGATTRTHLDTKAIRPRFNADPGRIINGTEASLGATRHQVGIRKALNDGY 71
            ||.:.|||:     |||:..:||               |||.|.|....:...||.:       |
 Frog     4 LLVLPLLLL-----LRGSEAQTH---------------RIIGGEECVPHSQPWQVAL-------Y 41

  Fly    72 FFGTGHLCGGSLIRPGWVLTAAHCFVDQIIYDGTFVPKEEFIVVMGNLDRYNRTNTLTFTIEERI 136
            :| :..:|||.||...||||||||            .:....|::|..:|.:.|....:|...:|
 Frog    42 YF-SDFICGGVLINEWWVLTAAHC------------NQSNLQVLLGAHNRTSPTGDEQYTYAAKI 93

  Fly   137 MQLDKFDLSTYDKDIALLMLNGTVPTGHPTIRPIALNRFAIPEGVVCQVTGWGNT---EDGYVSD 198
            .....|:..|||.||.||.|...... :..:.||.|..:.:.:...|..:|||:|   |:.|..:
 Frog    94 CPHQDFEPVTYDNDIMLLKLASEADI-NTWVAPIPLASYLVDDNSECLASGWGSTTSPEETYPGE 157

  Fly   199 ILMTVDVPMISEEHCINDSDLGHLIQPGMICAGYLEVGEKDACAGDSGGPLVCQSELAGVVSWG- 262
             |..|::..:|...| .|......|...|:|||.: .|.||.|.|||||||||..||.|:.||| 
 Frog   158 -LQCVNITTVSNSDC-QDYYPRDTITDNMLCAGDV-AGGKDTCGGDSGGPLVCNEELHGITSWGD 219

  Fly   263 IQCALPRLPGVYTEVSYYYDWILQNMGEN 291
            :.|..|..|||:.:||.|.|||...| ||
 Frog   220 LVCGSPDKPGVFAKVSNYIDWISDVM-EN 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 85/242 (35%)
LOC100485347XP_002941066.3 Tryp_SPc 23..244 CDD:238113 86/244 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.