DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and tmprss11f

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_004911133.1 Gene:tmprss11f / 100379970 XenbaseID:XB-GENE-1012399 Length:427 Species:Xenopus tropicalis


Alignment Length:288 Identity:102/288 - (35%)
Similarity:142/288 - (49%) Gaps:37/288 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLIFLPSGLRGATTRTHLDTKAIRPRFNADPGRIINGTEASLGATRHQVGIRKALNDGYFFGTGH 77
            ||..:||.....|| |..|..|......:...||:.||.|.||:...|..:|       ..|: |
 Frog   165 LLYSVPSTTTAYTT-TAADFTACGIGGPSVSNRIVGGTNAGLGSWPWQASLR-------LLGS-H 220

  Fly    78 LCGGSLIRPGWVLTAAHCFVDQIIYDGTFVPKEEFIVVMGNLDRYNRTNTLTFTIEERIMQLDKF 142
            .||.||:...|::.|||||       ........:.||:|.::.|:.:.   |.| |:|:..:.:
 Frog   221 TCGASLLNDTWLVAAAHCF-------DMNADANSWTVVLGTINVYSGSE---FKI-EKIIIYEGY 274

  Fly   143 DLSTYDKDIALLM----LNGTVPTGHPTIRPIALNRFA--IPEGVVCQVTGWGN-TEDGYVSDIL 200
            ....:..|||||.    ||.|     ..|||:.|...:  .|:|..|.:||||. |:.|..|.:|
 Frog   275 TSHNHRNDIALLKLFTPLNFT-----SIIRPVCLPEASDIFPDGSSCYITGWGALTDGGSASQVL 334

  Fly   201 MTVDVPMISEEHCINDSDLGHLIQPGMICAGYLEVGEKDACAGDSGGPLVCQSE----LAGVVSW 261
            ...:|.:|:.:.|.:....|.||.|.|||||| ..|:.|:|.||||||||....    |.|:||:
 Frog   335 QQAEVKIINSDTCSSSQMYGGLIYPSMICAGY-ATGQIDSCQGDSGGPLVTLKSGRWVLIGIVSF 398

  Fly   262 GIQCALPRLPGVYTEVSYYYDWILQNMG 289
            |..||||..||||:.::|..:||..:.|
 Frog   399 GYGCALPNKPGVYSRITYLRNWITAHSG 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 90/249 (36%)
tmprss11fXP_004911133.1 SEA 48..148 CDD:396113
Tryp_SPc 197..421 CDD:238113 89/248 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.