DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and zgc:165423

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_005164170.1 Gene:zgc:165423 / 100101646 ZFINID:ZDB-GENE-070720-11 Length:538 Species:Danio rerio


Alignment Length:310 Identity:105/310 - (33%)
Similarity:142/310 - (45%) Gaps:65/310 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFGLGQLLAVALLLI----FLPSGLRGATTRTHLDTKAIRPRFNADPGRIINGTEASLG-----A 56
            ||....||.|..||.    ..|:....|..:..|:||            |:.||.||.|     |
Zfish     1 MFWKLSLLCVVTLLSTGCDCQPTQSPPACGKAPLNTK------------IVGGTNASAGSWPWQA 53

  Fly    57 TRHQVGIRKALNDGYFFGTGHLCGGSLIRPGWVLTAAHCFVDQIIYDGTFVPK-EEFIVVMGNLD 120
            :.|:.|             .|.||||||...|:|:|||||...        |. .::.|.:|...
Zfish    54 SLHESG-------------SHFCGGSLISDQWILSAAHCFPSN--------PNPSDYTVYLGRQS 97

  Fly   121 R-YNRTNTLTFTIEERIMQLDKFDLSTYDKDIALLMLNGTVPTGHPTIRPIALNRFAIPEGV--- 181
            : ....|.::.::.:.|:. ..:..||:|.|:|||.|:..| |....|:|:.|    ..:|.   
Zfish    98 QDLPNPNEVSKSVSQVIVH-PLYQGSTHDNDMALLHLSSPV-TFSNYIQPVCL----AADGSTFY 156

  Fly   182 --VCQVTGWGNTEDGYVS----DILMTVDVPMISEEHCINDSDLGHLIQPGMICAGYLEVGEKDA 240
              ...:||||..|.| ||    .||..|:||::....|......|..|...|:|||.:: |.||:
Zfish   157 NDTMWITGWGTIESG-VSLPSPQILQEVNVPIVGNNLCNCLYGGGSSITNNMMCAGLMQ-GGKDS 219

  Fly   241 CAGDSGGPLVCQS----ELAGVVSWGIQCALPRLPGVYTEVSYYYDWILQ 286
            |.||||||:|.:|    ..|||||:|..||.|..||||..||.|.:||.|
Zfish   220 CQGDSGGPMVIKSFNTWVQAGVVSFGKGCADPNYPGVYARVSQYQNWISQ 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 90/258 (35%)
zgc:165423XP_005164170.1 Tryp_SPc 37..267 CDD:214473 91/270 (34%)
Tryp_SPc 38..269 CDD:238113 92/259 (36%)
Tryp_SPc 299..473 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.