DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and LOC100004427

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_005163955.1 Gene:LOC100004427 / 100004427 -ID:- Length:302 Species:Danio rerio


Alignment Length:301 Identity:91/301 - (30%)
Similarity:128/301 - (42%) Gaps:64/301 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFGLGQLLAVALLLIFLPSGLRGATT---RTHLDTKAIRPRFNADPGRIINGTEASLGATRHQVG 62
            ||.....:|.|:||..  :|..|.:.   |..|:||            |:.|..|:.|:...|..
Zfish     2 MFNTVFCVAGAVLLNI--AGCLGQSDVCGRAPLNTK------------IVGGLNATEGSWPWQAS 52

  Fly    63 IRKALNDGYFFGTGH-LCGGSLIRPGWVLTAAHCF-----VDQIIYDGTFVPKEEFIVVMGNLDR 121
            |.       |..||. .|.||||...||||||.||     .|.:||                |.|
Zfish    53 IN-------FKSTGQFFCSGSLISERWVLTAASCFQRINVSDVVIY----------------LGR 94

  Fly   122 YNRTNTLTFTIEERIMQLDKFDLSTYDKDIALLMLNGTVPTGHPTIRPIALNR--FAIPEGVVCQ 184
            .....:..:.|...::|:      :..:||||:.|:.:| |....|||:.|..  ....:|....
Zfish    95 LTTNGSNPYEIPRTVIQV------SVTEDIALVQLSSSV-TFTDYIRPVCLAAAGSVFVDGTESW 152

  Fly   185 VTGWGNTEDGYV--SDILMTVDVPMISEEHCINDSDLGHLIQPGMICAGYLEVGEKDACAGDSGG 247
            |||||:|....|  ||:|..|:.|:::...|.|.:.:.:|  ..:||||::....|..|..|.|.
Zfish   153 VTGWGSTSSTNVILSDMLKEVEAPIVNNIECSNINGITNL--DNVICAGFVNETGKAPCWEDFGS 215

  Fly   248 PLV----CQSELAGVVSWGIQCALPRLPGVYTEVSYYYDWI 284
            |||    .|...:|||.:.. |.....|.:|..||.|.:||
Zfish   216 PLVTRQGSQWIQSGVVVFTF-CGQNGFPTLYARVSEYEEWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 77/252 (31%)
LOC100004427XP_005163955.1 Tryp_SPc 35..255 CDD:214473 78/264 (30%)
Tryp_SPc 36..257 CDD:238113 79/253 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.