DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and Klk10

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_598473.1 Gene:Klk10 / 69540 MGIID:1916790 Length:278 Species:Mus musculus


Alignment Length:289 Identity:66/289 - (22%)
Similarity:110/289 - (38%) Gaps:63/289 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKVWAILAIALFLGALASGESLSSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSG 65
            |.::||  |.||.|...|:...|.:           .|.....:...:|||:        .:...
Mouse    26 MVQLWA--AQALLLPGNATRVDLEA-----------SGAQCERDYHPWQVSL--------FHNLQ 69

  Fly    66 HLCGGVVISQRLVATAAHCCYITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQ----QLITH 126
            ..|.||::.|..|.|||| |:.....:.|...:.:|:.....|.|::........|    .::.|
Mouse    70 FQCAGVLVDQNWVLTAAH-CWRNKPLRARVGDDHLLLFQKEQLRSTSSPVFHPKYQACSGPILPH 133

  Fly   127 ENYNPDALTNDIALMFINGYIPWNWPTVTALALNSQLVATNT---------------DCLISGWG 176
            .:...|.:                     .|.|:|.::.|:.               :|.:||||
Mouse   134 RSDEHDLM---------------------MLKLSSPVMLTSNVHPVQLPFRCSQPGQECQVSGWG 177

  Fly   177 LLQQNGTFSSNTLQAATVPIVSYTTCRISYNSIPVSQVCAGYLSGGVDACQGDSGGPMSCNGMLA 241
            .........:.:|..:.|.::|...|...|..:..:.:......|..|:||.|||||:.|:..|.
Mouse   178 TSASRRVKYNRSLSCSKVTLLSQKQCETFYPGVITNSMICAEADGNQDSCQSDSGGPLVCDDTLH 242

  Fly   242 GIVSYGA-GCAAPGYPGVYTNVSYYYDWI 269
            |::|:|. .|.|..:|.||:.:..|..||
Mouse   243 GVLSWGIYPCGAAQHPSVYSEICKYTPWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 55/254 (22%)
Tryp_SPc 35..272 CDD:238113 57/255 (22%)
Klk10NP_598473.1 Tryp_SPc 50..271 CDD:214473 55/250 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.