DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and Prss55

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:XP_008769022.1 Gene:Prss55 / 683415 RGDID:1586875 Length:321 Species:Rattus norvegicus


Alignment Length:309 Identity:85/309 - (27%)
Similarity:137/309 - (44%) Gaps:65/309 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCGGVVISQRLVATAAHCCYITDKKKYRTAGE 98
            :|:||.:|.:.:..:||||:  .||.      |.|||.::|:..:.|.|||.|    .:..:..|
  Rat    34 RIIGGQEAEVGEFPWQVSIQ--ENDH------HFCGGSILSEWWILTVAHCFY----SQELSPTE 86

  Fly    99 FVLVMGSTYLTSSTDRTLMYYLQQLITHENYNPDALTNDIALMFINGYIPWNWPTVTALALNSQL 163
            ..:.:|:..||:|   .:...:..:|.|:::...::.|||||:.:...:.:|..||.........
  Rat    87 LTVRVGTNDLTTS---PMELQVTNIIRHKDFKRHSMDNDIALLLLANPLTFNEQTVPICMPLQPT 148

  Fly   164 VATNTDCLISGWGLLQQNGTFSSN-TLQAATVPIVSYTTCRISYNSIPVSQVCAGYLSGGVDACQ 227
            ..:..:|.::|||........|.| .|....:.|..:..|...:.|:..:.:||.|.:...||||
  Rat   149 PPSWQECWVAGWGTTNSADKESMNMDLMKVPMRITDWKECLQLFPSLTTNMLCASYGNESFDACQ 213

  Fly   228 GDSGGPMSCN------GMLAGIVSYGAGCAAPGYPGVYTNVSYYYDWI----------------- 269
            ||||||:.||      ....||:|:|..|...|.||:||.::.|..||                 
  Rat   214 GDSGGPLVCNQESDGRWYQVGIISWGKSCGQKGSPGIYTVLANYILWIEKITQIEGKPLDLNSQM 278

  Fly   270 ------VQKNS------SLNYTIYHNGGVRQGSSWSYLGILPLLVAFLL 306
                  .:||:      :|||.          .||    :||.|::|.|
  Rat   279 VSVKKKTRKNNQTSKCPALNYP----------QSW----LLPCLLSFAL 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 71/241 (29%)
Tryp_SPc 35..272 CDD:238113 73/266 (27%)
Prss55XP_008769022.1 Tryp_SPc 35..264 CDD:238113 73/243 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.