DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and 2210010C04Rik

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_075822.3 Gene:2210010C04Rik / 67373 MGIID:1914623 Length:247 Species:Mus musculus


Alignment Length:270 Identity:97/270 - (35%)
Similarity:136/270 - (50%) Gaps:42/270 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LFLGALASGESLSSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSG-HLCGGVVISQ 75
            :||..|.:..:|..:..   :.||||||......:.||||:          .|| |.|||.:|:.
Mouse     5 IFLAFLGAAVALPLDDD---DDKIVGGYTCQRNALPYQVSL----------NSGYHFCGGSLINS 56

  Fly    76 RLVATAAHCCYITDKKKYRT-----AGEF---VLVMGSTYLTSSTDRTLMYYLQQLITHENYNPD 132
            :.|.:||||        |::     .||.   .|..|..::.::          ::|.|.|||.:
Mouse    57 QWVVSAAHC--------YKSRIQVRLGEHNIDALEGGEQFIDAA----------KIIRHPNYNAN 103

  Fly   133 ALTNDIALMFINGYIPWNWPTVTALALNSQLVATNTDCLISGWGLLQQNGTFSSNTLQAATVPIV 197
            ...|||.|:.:......| ..|:.:||.....:..|.||:||||....:||...:.||....|::
Mouse   104 TYNNDIMLIKLKTAATLN-SRVSTVALPRSCPSAGTRCLVSGWGNTLSSGTNYPSLLQCLDAPVL 167

  Fly   198 SYTTCRISY-NSIPVSQVCAGYLSGGVDACQGDSGGPMSCNGMLAGIVSYGAGCAAPGYPGVYTN 261
            |.::|..|| ..|..:..|.|:|.||.|:||||||||:.|||.|.|:||:|.|||..|.|||||.
Mouse   168 SDSSCTSSYPGKITSNMFCLGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGYGCAQRGKPGVYTK 232

  Fly   262 VSYYYDWIVQ 271
            |..|.:||.|
Mouse   233 VCKYVNWIQQ 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 90/244 (37%)
Tryp_SPc 35..272 CDD:238113 92/247 (37%)
2210010C04RikNP_075822.3 Tryp_SPc 24..240 CDD:214473 90/244 (37%)
Tryp_SPc 25..243 CDD:238113 92/247 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.