DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and prss1

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_571783.2 Gene:prss1 / 65223 ZFINID:ZDB-GENE-010131-7 Length:247 Species:Danio rerio


Alignment Length:272 Identity:99/272 - (36%)
Similarity:141/272 - (51%) Gaps:42/272 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AILAIALFLGALASGESLSSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSG-HLCG 69
            |.:.:|||..|.|:       ..|..:.||||||:.:...|.||||:          .|| |.||
Zfish     3 AFILLALFAVAYAA-------PLGDDDDKIVGGYECTKNGVPYQVSL----------NSGYHFCG 50

  Fly    70 GVVISQRLVATAAHCCYITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHENYNPDAL 134
            |.:||...|.:||||        |::..:..|...:..:|..|::.:  ..:::|.|.:||.:.|
Zfish    51 GSLISNLWVVSAAHC--------YKSRVQVRLGEHNIDVTEGTEQFI--NSEKVIRHPSYNSNTL 105

  Fly   135 TNDIALM------FINGYIPWNWPTVTALALNSQLVATNTDCLISGWGLLQQNGTFSSNTLQAAT 193
            .||:.|:      .||.|       |..::|.|...::.|.|||||||.:..:|:...:.|....
Zfish   106 DNDVMLIKLSSSAQINSY-------VKTVSLPSSCASSGTSCLISGWGNMSASGSNYPSRLMCLN 163

  Fly   194 VPIVSYTTCRISY-NSIPVSQVCAGYLSGGVDACQGDSGGPMSCNGMLAGIVSYGAGCAAPGYPG 257
            .||:|.:|||.:| ..|..:..|||::.||.|:||||||||:.||..|.||||:|.|||....||
Zfish   164 APILSDSTCRNAYPGQISSNMFCAGFMEGGKDSCQGDSGGPVVCNNQLQGIVSWGYGCAQRNKPG 228

  Fly   258 VYTNVSYYYDWI 269
            ||..|..:..||
Zfish   229 VYAKVCNFTTWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 90/242 (37%)
Tryp_SPc 35..272 CDD:238113 91/243 (37%)
prss1NP_571783.2 Tryp_SPc 24..240 CDD:214473 90/242 (37%)
Tryp_SPc 25..243 CDD:238113 91/243 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.