DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and CG17242

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001259921.1 Gene:CG17242 / 59226 FlyBaseID:FBgn0250841 Length:245 Species:Drosophila melanogaster


Alignment Length:254 Identity:66/254 - (25%)
Similarity:104/254 - (40%) Gaps:54/254 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 IEQVSYQVSIRLTANDKKSYGSGHLCGGVVISQRLVATAAHCCYITDKKKYRTAGEFVLV----- 102
            |||..:|.|:::  |||      |.||||:.|:.::.|.|.|.     :|.|.  ||:.|     
  Fly    24 IEQAPWQASVQI--NDK------HHCGGVIYSEDIILTIAECV-----RKARL--EFISVRVGSA 73

  Fly   103 ---MGSTYLTSSTDRTLMYYLQQLITHENYNPDALTNDIAL------MFINGYIPWNWPTVTALA 158
               .|.|.|.....|..:..|:             .:|:|:      ::::|       .:.|:.
  Fly    74 QENAGGTVLKVEKMRLQVLGLR-------------PSDVAILQLRSPLYLDG-------GIRAIP 118

  Fly   159 LNSQLVATNTDCLISGWGLLQQNGTFSSNTLQAATVPIVSYTTC----RISYNSIPVSQVCAGYL 219
            |.:..:...|:..:||||.|..... ||..|....|.|.....|    .:....:.|.::||...
  Fly   119 LATIPLVPGTNASVSGWGQLSAMNP-SSEVLLRVDVKIQDQLMCATNLALKGRLMSVGEICAAPA 182

  Fly   220 SGGVDACQGDSGGPMSCNGMLAGIVSYGAGCAAPGYPGVYTNVSYYYDWIVQKNSSLNY 278
            .....||||..|||:..|..|.||:|:.:.|.......||.|::.:..||......:|:
  Fly   183 GEIPYACQGFVGGPLVANNRLYGILSWQSACDVLNKSSVYANIAMFKVWIESTVKLMNF 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 63/243 (26%)
Tryp_SPc 35..272 CDD:238113 65/246 (26%)
CG17242NP_001259921.1 Tryp_SPc 24..235 CDD:238113 65/246 (26%)
Tryp_SPc 24..232 CDD:214473 63/243 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.