DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and CG17239

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster


Alignment Length:275 Identity:90/275 - (32%)
Similarity:127/275 - (46%) Gaps:50/275 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WAILAIALFLGALASGESLSSETAGKIEPKIVGGYDASIEQVSYQVSI-RLTANDKKSYGSGHLC 68
            |..||.           |::..::..|..:||||...:|..|.:|.|| ||        |..| |
  Fly     5 WIFLAF-----------SVTVVSSNWIPERIVGGDLITILSVPWQASILRL--------GRFH-C 49

  Fly    69 GGVVISQRLVATAAHCCYITDKK----KYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHENY 129
            |..:.|:.:|.|||||  :||::    ..|....|....|.....||           ::.||.|
  Fly    50 GAAIYSEDIVITAAHC--LTDRETEFLSVRVGSSFTFFGGQVVRVSS-----------VLLHEEY 101

  Fly   130 NPDALTNDIALMFINGYIPWNWPTVTALALNSQLVATNTDCLISGWGLLQQNGTFSSN---TLQA 191
            : .:.:||||:|.:...:... ..|:.:.|.....|:.:...:||||.:    .|..|   ::.:
  Fly   102 D-QSWSNDIAVMRLQSKLRLG-SAVSVIPLADTPPASGSPATVSGWGAI----GFKKNYPMSILS 160

  Fly   192 ATVPIVSYTTCRISY-NSIPVSQVCAGYLSGGVDACQGDSGGPMSCNGMLAGIVSYGAGCAAPGY 255
            |:|.||....||.|| ..|....:||.  :.|.|||.||||||:.....|.||||:|..||.|.|
  Fly   161 ASVDIVDQDQCRRSYGRKITKDMICAA--APGKDACSGDSGGPLVSGNKLVGIVSFGKECAHPEY 223

  Fly   256 PGVYTNVSYYYDWIV 270
            ||||.||:....||:
  Fly   224 PGVYANVAELKPWIL 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 83/243 (34%)
Tryp_SPc 35..272 CDD:238113 85/245 (35%)
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 83/243 (34%)
Tryp_SPc 24..237 CDD:238113 83/242 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.