DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and Klk4

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_064312.1 Gene:Klk4 / 56640 MGIID:1861379 Length:255 Species:Mus musculus


Alignment Length:273 Identity:91/273 - (33%)
Similarity:133/273 - (48%) Gaps:41/273 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FLGAL---ASGESLSSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCGGVVIS 74
            |||.|   .:|.|.||     :..:|:.|.|.|.....:|.:  |.:.|      |..|.||::.
Mouse    12 FLGCLILEVTGASASS-----VSSRIIQGQDCSPHSQPWQAA--LFSED------GFFCSGVLVH 63

  Fly    75 QRLVATAAHCCYITDKKKYRTAGEFVLVMGSTYLTSSTD---RTLMYYLQQLITHENYNPDALTN 136
            .:.|.:||||          ....:::.:|...|..|.:   |.|..:|.  |.|.|:|..:..|
Mouse    64 PQWVLSAAHC----------LQESYIVGLGLHNLKGSQEPGSRMLEAHLS--IQHPNFNDPSFAN 116

  Fly   137 DIALMFIN-GYIPWNWPTVTALALNSQLVATNTDCLISGWGLLQQNGTFSSNTLQAATVPIVSYT 200
            |:.|:.:| ..|..|  |:.::.:.:|.......||:||||.| :||...| .||...:.:.|..
Mouse   117 DLMLIKLNESVIESN--TIRSIPVATQCPTPGDTCLVSGWGQL-KNGKLPS-LLQCVNLSVASEE 177

  Fly   201 TCRISYNSI-PVSQVCAGYLSGGVDACQGDSGGPMSCNGMLAGIVSYGAG-CAAPGYPGVYTNVS 263
            |||:.|:.: .:|..|||......|:|.||||||:.||..|.|:||.|.| |..||.|.||||:.
Mouse   178 TCRLLYDPVYHLSMFCAGGGQDQKDSCNGDSGGPIVCNRSLQGLVSMGQGKCGQPGIPSVYTNLC 242

  Fly   264 YYYDW---IVQKN 273
            .:.:|   |:|.|
Mouse   243 KFTNWIQTIIQTN 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 80/243 (33%)
Tryp_SPc 35..272 CDD:238113 81/245 (33%)
Klk4NP_064312.1 Tryp_SPc 32..251 CDD:238113 80/242 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.