DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and KLK10

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001070968.1 Gene:KLK10 / 5655 HGNCID:6358 Length:276 Species:Homo sapiens


Alignment Length:290 Identity:76/290 - (26%)
Similarity:117/290 - (40%) Gaps:66/290 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKVWAILAIALFLGALASGESLSSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSG 65
            ||::||..|            :|..:...:::|:..|...|...| .:|||:        ..|..
Human    25 MAQLWAAEA------------ALLPQNDTRLDPEAYGSPCARGSQ-PWQVSL--------FNGLS 68

  Fly    66 HLCGGVVISQRLVATAAHCCYITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQL------I 124
            ..|.||::.|..|.|||||   .:|..:...|:              |..|:...:||      :
Human    69 FHCAGVLVDQSWVLTAAHC---GNKPLWARVGD--------------DHLLLLQGEQLRRTTRSV 116

  Fly   125 THENYNP-------------DALTNDIALMFINGYIPWNWPTVTALALNSQLVATNTDCLISGWG 176
            .|..|:.             |.:...:|...:.|      |.|.||.|..:.......|.::|||
Human   117 VHPKYHQGSGPILPRRTDEHDLMLLKLARPVVLG------PRVRALQLPYRCAQPGDQCQVAGWG 175

  Fly   177 LLQQNGTFSSNTLQAATVPIVSYTTCRISYNSIPV-SQVCAGYLSGGVDACQGDSGGPMSCNGML 240
            .........:..|..:::.|:|...|.:.|..:.. :.:||| |..|.|.||.|||||:.|:..|
Human   176 TTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAG-LDRGQDPCQSDSGGPLVCDETL 239

  Fly   241 AGIVSYGA-GCAAPGYPGVYTNVSYYYDWI 269
            .||:|:|. .|.:..:|.|||.:..|..||
Human   240 QGILSWGVYPCGSAQHPAVYTQICKYMSWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 67/255 (26%)
Tryp_SPc 35..272 CDD:238113 69/256 (27%)
KLK10NP_001070968.1 Tryp_SPc 49..272 CDD:238113 69/254 (27%)
Tryp_SPc 49..269 CDD:214473 67/252 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.