DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and si:dkey-33m11.8

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:XP_693464.3 Gene:si:dkey-33m11.8 / 565078 ZFINID:ZDB-GENE-141215-49 Length:251 Species:Danio rerio


Alignment Length:262 Identity:79/262 - (30%)
Similarity:121/262 - (46%) Gaps:43/262 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCGGVVISQRLVATAAHCCYITDKKKY 93
            |..:.:|:||.:.....:.||.|::        |.:.|.|||.:|..:.|.:||||        :
Zfish    18 GSKQQRIIGGQEVQPYSIKYQASVQ--------YNNYHYCGGTLIHPQWVVSAAHC--------W 66

  Fly    94 RTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHENYNPDALTNDIALMFIN-----------GYI 147
            |.:....:|:....|:.......::.:.:.:.|..||.....:||.|:.:.           ..:
Zfish    67 RPSYLIKVVLSEHDLSKIEGFERVFNVSKALVHYMYNYRTFDSDIMLLKLEKPAELSATIQPAVL 131

  Fly   148 PWNWPTVTALALNSQLVATNTDCLISGWGLLQQNGTFSSNTLQAATVPIVSYTTCR-ISYNSIPV 211
            |.:.|.:..          .|.|::||||:.|....:.|..|:|..|.|:  ..|: ..|..|..
Zfish   132 PVSVPALQG----------GTVCIVSGWGVTQVYSYYLSPVLRAVDVQII--PQCQYYYYYRITD 184

  Fly   212 SQVCAGYLSGGVDACQGDSGGPMSCNGMLAGIVSYGAGCAAPGYPGVYTNVSYY---YDWIVQKN 273
            :.||||...||.|:||||||||:.|||...||||:|..||...:|||||.|..|   ..||:..:
Zfish   185 NMVCAGSPLGGKDSCQGDSGGPLICNGYFEGIVSWGISCANAYFPGVYTKVRNYIPWMTWIIDND 249

  Fly   274 SS 275
            :|
Zfish   250 TS 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 75/249 (30%)
Tryp_SPc 35..272 CDD:238113 77/251 (31%)
si:dkey-33m11.8XP_693464.3 Tryp_SPc 23..241 CDD:214473 75/245 (31%)
Tryp_SPc 24..241 CDD:238113 75/244 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.