DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and PRSS3

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:XP_011516267.1 Gene:PRSS3 / 5646 HGNCID:9486 Length:333 Species:Homo sapiens


Alignment Length:247 Identity:91/247 - (36%)
Similarity:124/247 - (50%) Gaps:37/247 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 EPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCGGVVISQRLVATAAHCCYITDKKKYRT- 95
            :.||||||......:.||||:.         ...|.|||.:||::.|.:||||        |:| 
Human   107 DDKIVGGYTCEENSLPYQVSLN---------SGSHFCGGSLISEQWVVSAAHC--------YKTR 154

  Fly    96 ----AGEF---VLVMGSTYLTSSTDRTLMYYLQQLITHENYNPDALTNDIALMFINGYIPWNWPT 153
                .||.   ||.....::.::          ::|.|..||.|.|.|||.|:.::.....| ..
Human   155 IQVRLGEHNIKVLEGNEQFINAA----------KIIRHPKYNRDTLDNDIMLIKLSSPAVIN-AR 208

  Fly   154 VTALALNSQLVATNTDCLISGWGLLQQNGTFSSNTLQAATVPIVSYTTCRISY-NSIPVSQVCAG 217
            |:.::|.:...|..|:|||||||.....|....:.|:....|:::...|:.|| ..|..|..|.|
Human   209 VSTISLPTTPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVG 273

  Fly   218 YLSGGVDACQGDSGGPMSCNGMLAGIVSYGAGCAAPGYPGVYTNVSYYYDWI 269
            :|.||.|:||.|||||:.|||.|.|:||:|.|||....|||||.|..|.|||
Human   274 FLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWI 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 89/243 (37%)
Tryp_SPc 35..272 CDD:238113 90/244 (37%)
PRSS3XP_011516267.1 Tryp_SPc 109..325 CDD:214473 89/243 (37%)
Tryp_SPc 110..328 CDD:238113 90/244 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.