DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and PRSS1

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:XP_011514713.1 Gene:PRSS1 / 5644 HGNCID:9475 Length:472 Species:Homo sapiens


Alignment Length:253 Identity:93/253 - (36%)
Similarity:128/253 - (50%) Gaps:41/253 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 EPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSG-HLCGGVVISQRLVATAAHCCYITDKKKYRT 95
            :.||||||:.....|.||||:          .|| |.|||.:|:::.|.:|.||        |::
Human   246 DDKIVGGYNCEENSVPYQVSL----------NSGYHFCGGSLINEQWVVSAGHC--------YKS 292

  Fly    96 -----AGEF---VLVMGSTYLTSSTDRTLMYYLQQLITHENYNPDALTNDIALMFINGYIPWNWP 152
                 .||.   ||.....::.::          ::|.|..|:...|.|||.|:.::.....| .
Human   293 RIQVRLGEHNIEVLEGNEQFINAA----------KIIRHPQYDRKTLNNDIMLIKLSSRAVIN-A 346

  Fly   153 TVTALALNSQLVATNTDCLISGWGLLQQNGTFSSNTLQAATVPIVSYTTCRISY-NSIPVSQVCA 216
            .|:.::|.:...||.|.|||||||....:|....:.||....|::|...|..|| ..|..:..|.
Human   347 RVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKITSNMFCV 411

  Fly   217 GYLSGGVDACQGDSGGPMSCNGMLAGIVSYGAGCAAPGYPGVYTNVSYYYDWIVQKNS 274
            |:|.||.|:||||||||:.|||.|.|:||:|.|||....|||||.|..|..||  ||:
Human   412 GFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWI--KNT 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 89/244 (36%)
Tryp_SPc 35..272 CDD:238113 90/246 (37%)
PRSS1XP_011514713.1 Ig 19..119 CDD:299845
IG_like 29..113 CDD:214653
Tryp_SPc 248..464 CDD:214473 89/244 (36%)
Tryp_SPc 249..467 CDD:238113 91/248 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.