DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and zmp:0000001088

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:XP_688573.1 Gene:zmp:0000001088 / 560086 ZFINID:ZDB-GENE-140106-48 Length:263 Species:Danio rerio


Alignment Length:258 Identity:93/258 - (36%)
Similarity:130/258 - (50%) Gaps:30/258 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ESLSSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCGGVVISQRLVATAAHCC 85
            |.|:......|:.:|||||..:...:.|.|||       :|....|.|||.:|::..|.|||| |
Zfish    13 EILAVSCQDVIQARIVGGYVPAPYSIKYIVSI-------QSATGQHFCGGTLINKYWVLTAAH-C 69

  Fly    86 YITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHENYNPDALTNDIAL------MFIN 144
            .|.:......||::     |..|....::....::  ||.|..|:......||.|      :::|
Zfish    70 NIGEANMRIVAGDY-----SVGLYEGMEQFRRPHM--LIPHPQYDRSTNNADIMLIKLQSPVYLN 127

  Fly   145 GYIPWNWPTVTALALNSQLVATNTDCLISGWGLLQQNGTFSSNTLQAATVPIVSYTTCR--ISYN 207
            .|:     ::..|.....:||....|.:||||.....|..|| .|:...:||||...|.  .|:|
Zfish   128 SYV-----SLVPLPRQDAMVAVGRLCSVSGWGFTTSTGGISS-ILRTVKLPIVSTAVCNGTDSFN 186

  Fly   208 -SIPVSQVCAGYLSGGVDACQGDSGGPMSCNGMLAGIVSYGAGCAAPGYPGVYTNVSYYYDWI 269
             :|..:.:||||.:||.|||:||||||:.|.|.:.||||:|.|||...||||||.||.:..||
Zfish   187 GNITENMICAGYSTGGKDACKGDSGGPLVCEGRVYGIVSWGNGCADAQYPGVYTAVSQFRQWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 88/243 (36%)
Tryp_SPc 35..272 CDD:238113 90/244 (37%)
zmp:0000001088XP_688573.1 Tryp_SPc 26..249 CDD:214473 88/243 (36%)
Tryp_SPc 27..252 CDD:238113 90/244 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.