DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and LOC560023

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:XP_021325702.1 Gene:LOC560023 / 560023 -ID:- Length:271 Species:Danio rerio


Alignment Length:282 Identity:91/282 - (32%)
Similarity:138/282 - (48%) Gaps:47/282 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VWAILAIALFLGALASGESLSSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLC 68
            :|..|.:|:.:             ......:|:||.:.....:.||||:::   |:|     |.|
Zfish    26 LWVFLVLAVMV-------------RDAFSQRIIGGQEVVPYSIKYQVSLQV---DRK-----HFC 69

  Fly    69 GGVVISQRLVATAAHCCYITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHENYNPDA 133
            ||.:|..:.|.|||||        :|.|....:|:....|........:..:.::.:|..|||..
Zfish    70 GGTLIQPQWVLTAAHC--------WRPASVIQVVLSEHNLAVEEGFEQVCTVAKVFSHVAYNPKT 126

  Fly   134 LTNDIALM------FINGYI-PWNWPTVTALALNSQLVATNTDCLISGWGLLQQNGTFSSNTLQA 191
            ..|||.::      .||.|: |...||.     ::..:|..:.|.:||||:.:....:.|..|:|
Zfish   127 FNNDIMIIKLTAPAQINAYVQPALLPTA-----DTPELAGGSSCTVSGWGVTRLYNFYLSPILRA 186

  Fly   192 ATVPIVSYTTCRI-SYNSIPVSQVCAGYLSGGVDACQGDSGGPMSCNGMLAGIVSYGAGCAAPGY 255
            ..|.|  :::|:: .|..:..:.:|||...||.|:||||||||:.|:|.|.||||:|.|||.|.|
Zfish   187 VDVEI--FSSCQLYYYYRVNDNMICAGSRFGGKDSCQGDSGGPLICDGYLEGIVSWGIGCALPYY 249

  Fly   256 PGVYTNVSYY---YDWIVQKNS 274
            |||||.|..|   .|||:...|
Zfish   250 PGVYTKVRNYNRWIDWIISTES 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 85/245 (35%)
Tryp_SPc 35..272 CDD:238113 87/247 (35%)
LOC560023XP_021325702.1 Tryp_SPc 43..263 CDD:214473 84/242 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.