DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and KLK15

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_059979.2 Gene:KLK15 / 55554 HGNCID:20453 Length:256 Species:Homo sapiens


Alignment Length:280 Identity:84/280 - (30%)
Similarity:126/280 - (45%) Gaps:45/280 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VWAILAIALFLGALASGESLSSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHL- 67
            :|.:|.::..|          :.||.:...|::.|.:.:.....:||::         |..|.. 
Human     1 MWLLLTLSFLL----------ASTAAQDGDKLLEGDECAPHSQPWQVAL---------YERGRFN 46

  Fly    68 CGGVVISQRLVATAAHCCYITDKKKYRTAGEFVLV-MGSTYLTSSTDRTLMYYLQQLITHENYNP 131
            ||..:||...|.:||||           ...|:.| :|...|........:....::|.|..|..
Human    47 CGASLISPHWVLSAAHC-----------QSRFMRVRLGEHNLRKRDGPEQLRTTSRVIPHPRYEA 100

  Fly   132 DALTNDIALMFINGYIPWNWPTVTALALNSQLVATNTDCLISGWGLLQQN--GTFSS-------- 186
            .:..|||.|:.:......| |.|....|.::.......|::|||||:..|  ||..|        
Human   101 RSHRNDIMLLRLVQPARLN-PQVRPAVLPTRCPHPGEACVVSGWGLVSHNEPGTAGSPRSQVSLP 164

  Fly   187 NTLQAATVPIVSYTTCRISY-NSIPVSQVCAGYLSGGVDACQGDSGGPMSCNGMLAGIVSYG-AG 249
            :||..|.:.|:|.|:|..|| ..:..:.||||....|.::|:||||||:.|.|:|.||||:| ..
Human   165 DTLHCANISIISDTSCDKSYPGRLTNTMVCAGAEGRGAESCEGDSGGPLVCGGILQGIVSWGDVP 229

  Fly   250 CAAPGYPGVYTNVSYYYDWI 269
            |.....|||||.|.:|.:||
Human   230 CDNTTKPGVYTKVCHYLEWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 77/248 (31%)
Tryp_SPc 35..272 CDD:238113 78/249 (31%)
KLK15NP_059979.2 Tryp_SPc 25..249 CDD:214473 76/244 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.