DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and Elane

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_056594.2 Gene:Elane / 50701 MGIID:2679229 Length:265 Species:Mus musculus


Alignment Length:270 Identity:84/270 - (31%)
Similarity:121/270 - (44%) Gaps:37/270 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AKVWAILAIALFLGALASGESLSSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSGH 66
            ::..|.:.:|||||    |.:|:||        ||||..|......:..|::..        .||
Mouse     8 SRTLAAMLLALFLG----GPALASE--------IVGGRPARPHAWPFMASLQRR--------GGH 52

  Fly    67 LCGGVVISQRLVATAAHCCYITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHENYNP 131
            .||..:|::..|.:||||   .:...:|:.   .:|:|:..|... :||...:..|.|....::|
Mouse    53 FCGATLIARNFVMSAAHC---VNGLNFRSV---QVVLGAHDLRRQ-ERTRQTFSVQRIFENGFDP 110

  Fly   132 DALTNDIALMFINGYIPWNWPT-VTALALNSQLVATNTDCLISGWGLLQQNGTFSSNTLQAATVP 195
            ..|.|||.::.:||....|... |..|....|.|...|.||..|||.|..|.. |.:.||...|.
Mouse   111 SQLLNDIVIIQLNGSATINANVQVAQLPAQGQGVGDRTPCLAMGWGRLGTNRP-SPSVLQELNVT 174

  Fly   196 IVSYTTCRISYNSIPVSQVCAGYLSGGVDACQGDSGGPMSCNGMLAGIVSY-GAGCAAPGYPGVY 259
            :|: ..||...|      ||..........|.||||||:.||.::.||.|: ..||.:..||..:
Mouse   175 VVT-NMCRRRVN------VCTLVPRRQAGICFGDSGGPLVCNNLVQGIDSFIRGGCGSGLYPDAF 232

  Fly   260 TNVSYYYDWI 269
            ..|:.:.|||
Mouse   233 APVAEFADWI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 72/236 (31%)
Tryp_SPc 35..272 CDD:238113 74/237 (31%)
ElaneNP_056594.2 Tryp_SPc 28..242 CDD:214473 73/244 (30%)
Tryp_SPc 29..245 CDD:238113 74/237 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.