DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and Prss53

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:XP_006230384.1 Gene:Prss53 / 499270 RGDID:1566127 Length:591 Species:Rattus norvegicus


Alignment Length:389 Identity:84/389 - (21%)
Similarity:141/389 - (36%) Gaps:131/389 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKVWA-----ILAIALFLGALASGESLSSETAGKIEPK----IVGGYDASIEQVSYQVSIRLTA 56
            |.:.|.     :.|:.:..|..|:..:......|..||:    :.|.:       .:|.|:|.. 
  Rat     1 MRQSWGPELLIVGAVIVIEGLQAAQRACGQRGPGPPEPQEGNTLPGEW-------PWQASVRRQ- 57

  Fly    57 NDKKSYGSGHLCGGVVISQRLVATAAHCCYITDKKKYRTA--GEFVLVMGSTY---LTSSTDRTL 116
                   ..|:|.|.:::...|.|||||.     :|..||  ..:.:|:||..   |:...:...
  Rat    58 -------GVHICSGSLVADTWVLTAAHCF-----EKMATAELSSWSVVLGSLKQEGLSPGAEEVG 110

  Fly   117 MYYLQQLITHENYNPDALTNDIALMFI--------------NGYIPWN---WPT----------- 153
            :..||   ..:.||..:..:|:||:.:              ..:.|:.   |.|           
  Rat   111 VAALQ---LPKAYNHYSQGSDLALLQLTHPIVHTTLCLPQPTHHFPFGASCWATGWDQNTSDGKY 172

  Fly   154 --------------VTALALNSQLVATNTDCLISGWGLLQQNGTFS----SNTLQAATVPIVSYT 200
                          :|.|||.|..|:             :.:.|.|    |.||:...:.::|..
  Rat   173 CPRHKSRESQTGSVLTVLALCSHCVS-------------ELDSTLSPLPVSRTLRNLRLRLISRP 224

  Fly   201 TCRISYNSI-------PV--SQVCAGYLSGGVDACQGDSGGPMSC-----NGMLAGIVSYGAGCA 251
            ||...||.:       |.  ..:|.|...|....||||||||:.|     :.:..||:|:.:.||
  Rat   225 TCNCLYNRLHQRLLANPARSGMLCGGAQPGVQGPCQGDSGGPVMCREPDGHWVQVGIISFTSNCA 289

  Fly   252 APGYPGVYTNVSYYYDW----------IVQ---------KNSSLNYTIYHNGGVRQG--SSWSY 294
            ....|.:.|:::.:..|          :||         :||.:......:||.:.|  |.|.:
  Rat   290 QEDTPVLLTDMAAHSSWLQAHVDRAAFLVQDPGVVKMSDENSCVACGSLSSGGPQAGALSQWPW 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 67/313 (21%)
Tryp_SPc 35..272 CDD:238113 69/320 (22%)
Prss53XP_006230384.1 Tryp_SPc 45..310 CDD:238113 67/300 (22%)
Tryp_SPc 341..561 CDD:238113 5/13 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.