DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and prss27

DIOPT Version :10

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:XP_031749235.1 Gene:prss27 / 496619 XenbaseID:XB-GENE-5744470 Length:724 Species:Xenopus tropicalis


Alignment Length:130 Identity:24/130 - (18%)
Similarity:48/130 - (36%) Gaps:44/130 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LVLANFVIFQVLNQI----ILWEIVYITFLR-ATVILEVRYGMKTENLKLYMRRFITVLFTIFLI 98
            |:.|.||:.|.|..:    :.|..::..|.. |..:..:.|.::.:.|::.|             
 Frog    16 LLRAVFVLRQGLACLQRLHVAWFYIHGVFYHLAKRLTGITYALRPDPLRVLM------------- 67

  Fly    99 NHTVRIFFHRIEEVTDNDMKVRELGIPCDSEKIYIIAAFAGDCLR-RILLTIAGLTSLIIPILIM 162
                        .|..:.:::|...:|             |:.|| |:...:.|:.||:..:|.|
 Frog    68 ------------SVAPSALQLRVRSLP-------------GEDLRARVSYRLLGVISLLHLVLSM 107

  Fly   163  162
             Frog   108  107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 24/130 (18%)
prss27XP_031749235.1 Tryp_SPc 34..271 CDD:238113 18/112 (16%)
Tryp_SPc 420..659 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.