DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and alphaTry

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster


Alignment Length:276 Identity:86/276 - (31%)
Similarity:141/276 - (51%) Gaps:26/276 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILAIALFLGAL--ASGESLSSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCG 69
            :|.|.:.|.|:  |.|.::......:::.:||||...:|....:|:|::.:.:        |.||
  Fly     1 MLKIVILLSAVVCALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGS--------HSCG 57

  Fly    70 GVVISQRLVATAAHCCYITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHENYNPDAL 134
            |.:.|..::.|||||....      :|....:..||||.:|.   .::..:.....||.||.:.:
  Fly    58 GSIYSANIIVTAAHCLQSV------SASVLQVRAGSTYWSSG---GVVAKVSSFKNHEGYNANTM 113

  Fly   135 TNDIALMFINGYIPWNWPTVTALALNSQLVATNTDCLISGWGLLQQNGTFSSNTLQAATVPIVSY 199
            .||||::.::..:.:: .::.|::|.:...|......:||||......:...:.||...|.|||.
  Fly   114 VNDIAVIRLSSSLSFS-SSIKAISLATYNPANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQ 177

  Fly   200 TTCRIS---YNS-IPVSQVCAGYLSGGVDACQGDSGGPMSCNGMLAGIVSYGAGCAAPGYPGVYT 260
            :.|..|   |.| |..:.:||.  :.|.||||||||||:...|:|.|:||:|.|||...|||||.
  Fly   178 SQCASSTYGYGSQIRNTMICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYA 240

  Fly   261 NVSYYYDWIVQKNSSL 276
            :|:....|:|...:|:
  Fly   241 DVAVLRSWVVSTANSI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 77/238 (32%)
Tryp_SPc 35..272 CDD:238113 79/240 (33%)
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 77/238 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.