DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and zgc:92590

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001007055.1 Gene:zgc:92590 / 474322 ZFINID:ZDB-GENE-041024-15 Length:247 Species:Danio rerio


Alignment Length:284 Identity:91/284 - (32%)
Similarity:137/284 - (48%) Gaps:45/284 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VWAILAIALFLGALASGESLSSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSG-HL 67
            |:|:|.:|:...|               :.||:|||:.|.....:|:.:        :|.:| ..
Zfish     5 VFALLVLAVACSA---------------DDKIIGGYECSPNSQPWQIYL--------TYDNGQRW 46

  Fly    68 CGGVVISQRLVATAAHCCYITDKKKYRTAGEFVLVMG--STYLTSSTDRTLMYYLQQLITHENYN 130
            ||..:|:.|...:||||        |..|....:.:|  :..:...|::.:.  .:::|.|..||
Zfish    47 CGASLINDRWAVSAAHC--------YLVANRLTVHLGEHNVAVEEGTEQRIK--AEKVIPHPKYN 101

  Fly   131 PDALTNDIALMFINGYIPWNWPTVTALALNSQLVATNTDCLISGWGLLQQNGTFSSNTLQAATVP 195
            ...|.||..|:.:.....:| ..|..:.|.:...:....||:||||.|...|....:.||...:|
Zfish   102 DYTLDNDFMLIKLKEPAVFN-QYVQPVPLTTSCSSEGEQCLVSGWGNLINTGVVYPDVLQCLNLP 165

  Fly   196 IVSYTTCRISYN-SIPVSQVCAGYLSGGVDACQGDSGGPMSCNGMLAGIVSYGAGCAAPGYPGVY 259
            :::...|..:|. .|..:..|||::.||.||||||||||:.|||.|.|:||:|.|||..||||||
Zfish   166 VLTRAQCEGAYGWQITKNMFCAGFMEGGKDACQGDSGGPVICNGELRGVVSWGYGCADSGYPGVY 230

  Fly   260 TNVSYYYDWIVQKNSSLNYTIYHN 283
            |.|..|.||:..       ||.:|
Zfish   231 TEVCRYTDWVAS-------TIANN 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 82/238 (34%)
Tryp_SPc 35..272 CDD:238113 82/240 (34%)
zgc:92590NP_001007055.1 Tryp_SPc 20..240 CDD:214473 82/238 (34%)
Tryp_SPc 21..243 CDD:238113 82/247 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.