DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and intr

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_651633.1 Gene:intr / 43397 FlyBaseID:FBgn0039599 Length:298 Species:Drosophila melanogaster


Alignment Length:315 Identity:64/315 - (20%)
Similarity:108/315 - (34%) Gaps:98/315 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILAIALFLGALASGESLSSETA-----GKI-----------------------EPKIVGGYDA-- 41
            ::.:|:..|::..    |||||     |:|                       .|||...:.:  
  Fly     7 VIILAVSRGSVYG----SSETAPQFNVGEIPSNGQPYQIVRVIEYIVPYPYQRSPKISARFSSGG 67

  Fly    42 -----SIEQVSYQVSIRLTANDKKS--------------YGSGHLCGGVVISQRLVATAAHCCYI 87
                 |:|.:..::...||.....:              |.:..:|.|.:||.|||.|:|.|...
  Fly    68 NKEPNSLEIIPAEIETLLTDGQATTEAPKAVKHFVMRILYENKVICSGALISTRLVLTSALCFPR 132

  Fly    88 T----DKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHENYNPDALTNDIALMFINGYIP 148
            |    ..:.|:.               ...|:.:|.:..|||       ....|:||:.:  :.|
  Fly   133 TLRQPPPRSYKL---------------QASRSRIYSVANLIT-------GAIEDMALLLL--HAP 173

  Fly   149 WNWPTVTALALNSQLVATNTDCLISGWGLLQQNGTFSSNTLQAATVPIVSYTTCRISYNS----- 208
            ...|.|..:.|....:..|.:..:          ..|...|:.....::..:.|:.||..     
  Fly   174 LEDPFVHPIDLCESPLRRNDNVTM----------YMSQQHLRFLRTKLIPNSNCKRSYAQDENAF 228

  Fly   209 IPVSQVCAGYLSGGVDACQGDSGGPMSCNGMLAGIVSYGAGCAAPGYPG-VYTNV 262
            |..:.:||...:..|| ||...|..:.....|.|:..||..|:..|..| :|.:|
  Fly   229 ITQTMLCALNSNRLVD-CQTAKGDVLLHQDRLCGVDIYGQHCSDGGVNGELYADV 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 54/260 (21%)
Tryp_SPc 35..272 CDD:238113 53/259 (20%)
intrNP_651633.1 Tryp_SPc 112..284 CDD:304450 47/206 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.