DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and CG7142

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster


Alignment Length:270 Identity:74/270 - (27%)
Similarity:114/270 - (42%) Gaps:41/270 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCGGVVISQRLVATAAHCCYITDKKKYRTAGE 98
            |.:...:|:.....|.|||::...|:   |..|.|.|.:|::..:.|||||.     ...:....
  Fly    79 KFLAKREATPHSAPYVVSIQMMTPDQ---GLVHYCAGTIINEHWILTAAHCL-----SSPQAVEN 135

  Fly    99 FVLVMGSTYL---TSSTDRTLMYYLQQLITHENYNPDALTNDIALMFINGYIPWNWPT-VTALAL 159
            .|:|.||..:   ........|.::...:.||.|.......||||::...  |..:.| |....|
  Fly   136 SVIVAGSHDIHDQKGEASNIQMRHIDYYVRHELYLGGVNPYDIALIYTKE--PLVFDTYVQPATL 198

  Fly   160 NSQLVATNTDCLISGWGLLQQNGTFS-------SNTLQAATVPIVSYTTCR--ISYNSIPV--SQ 213
            ..|      |....|:|.|...|..|       .:.||.|.:||:....|.  ::.:.:|:  :.
  Fly   199 PEQ------DAQPEGYGTLYGWGNVSMTAVPNYPHRLQEANMPILDMELCEQILARSGLPLHETN 257

  Fly   214 VCAGYLSGGVDACQGDSGGPM---SCN------GMLAGIVSYG-AGCAAPGYPGVYTNVSYYYDW 268
            :|.|.|:|||..|..|||||:   .|.      .::.||||:| ..|.....|.|:..||.:.:|
  Fly   258 LCTGPLTGGVSICTADSGGPLIQQCCEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEW 322

  Fly   269 IVQKNSSLNY 278
            |.|..|:..:
  Fly   323 INQVISTATH 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 70/259 (27%)
Tryp_SPc 35..272 CDD:238113 71/261 (27%)
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 71/257 (28%)
Tryp_SPc 84..323 CDD:214473 69/254 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455600
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.