DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and CG5255

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:284 Identity:89/284 - (31%)
Similarity:145/284 - (51%) Gaps:41/284 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILAIALFLGALASGESLSSETAGKI-------EPKIVGGYDASIEQVSYQVSIRLTANDKKSYGS 64
            :|.:.||          :|..|.:|       :.:||||.:|:.....||:|:       :..||
  Fly     5 LLPLVLF----------TSSAASQILYPPQYTKNRIVGGEEAAAGLAPYQISL-------QGIGS 52

  Fly    65 G-HLCGGVVISQRLVATAAHCCYITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHEN 128
            | |.|||.:|.:|.:.|||||      .:.|.|..|.::.|:..|..:..:  .||..:::.|.|
  Fly    53 GAHSCGGAIIDERWIITAAHC------TRGRQATAFRVLTGTQDLHQNGSK--YYYPDRIVEHSN 109

  Fly   129 YNPDALTNDIALMFINGYIPWNWPTVTALALNSQLVATNTDCLISGWGLLQQNGTFSSNTLQAAT 193
            |.|....|||||:.:|..|.::..| ..:.|:.:.:...:..|::|||.|...|...:. ||:..
  Fly   110 YAPRKYRNDIALLHLNESIVFDNAT-QPVELDHEALVPGSRLLLTGWGTLSLGGDVPAR-LQSLE 172

  Fly   194 VPIVSYTTCRISYNS---IPVSQVCAGYLSGGVDACQGDSGGPMSCNGMLAGIVSYGAGCAAPGY 255
            |..|.:..||.::::   :.:..||. :...|..||.||||||:..||.|..:|::|..| |.||
  Fly   173 VNYVPFEQCRAAHDNSTRVDIGHVCT-FNDKGRGACHGDSGGPLVHNGKLVALVNWGLPC-AKGY 235

  Fly   256 PGVYTNVSYYYDWIVQKNSSLNYT 279
            |..:.::|||:|:| :.:.||:.|
  Fly   236 PDAHASISYYHDFI-RTHLSLSKT 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 79/238 (33%)
Tryp_SPc 35..272 CDD:238113 80/240 (33%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 79/238 (33%)
Tryp_SPc 30..252 CDD:238113 80/241 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.