DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and CG5246

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster


Alignment Length:257 Identity:78/257 - (30%)
Similarity:116/257 - (45%) Gaps:45/257 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCGGVVISQRLVATAAHCC--------Y 86
            |.|.:::||.|:......|||||..|..:       |:|||.:|:.:.:.|||||.        .
  Fly    37 KPETRVIGGVDSPTGFAPYQVSIMNTFGE-------HVCGGSIIAPQWILTAAHCMEWPIQYLKI 94

  Fly    87 ITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHENYNPDALTNDIALMFINGYIPWNW 151
            :|....|...|...||.||.                  .|.:::..|..|||||  |:...|..:
  Fly    95 VTGTVDYTRPGAEYLVDGSK------------------IHCSHDKPAYHNDIAL--IHTAKPIVY 139

  Fly   152 PTVT---ALALNSQLVATNTDCLISGWGLLQQNGTFSSNTLQAATVPIVSYTTCRI---SYNSIP 210
            ..:|   .||....|........::|||..:..|.:|:. ||...:..:.:..|:.   :.|.:.
  Fly   140 DDLTQPIKLASKGSLPKVGDKLTLTGWGSTKTWGRYSTQ-LQKIDLNYIDHDNCQSRVRNANWLS 203

  Fly   211 VSQVCAGYLSGGVDACQGDSGGPM-SCNGMLAGIVSYGAGCAAPGYPGVYTNVSYYYDWIVQ 271
            ...||. :...|..:|.||||||: ..|..|.|:|::|..||. |||.|:.:|:||:|||.|
  Fly   204 EGHVCT-FTQEGEGSCHGDSGGPLVDANQTLVGVVNWGEACAI-GYPDVFGSVAYYHDWIEQ 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 73/249 (29%)
Tryp_SPc 35..272 CDD:238113 76/252 (30%)
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 73/249 (29%)
Tryp_SPc 42..263 CDD:238113 75/250 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.