DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and CG31266

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster


Alignment Length:245 Identity:68/245 - (27%)
Similarity:109/245 - (44%) Gaps:32/245 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCGGVVISQRLVATAAHCCYITDKKKYRTAG- 97
            :::||..|:.....:..||      :.:| |.||||.:::.:..|.|||.|          .|| 
  Fly    51 RVIGGTTAAEGNWPWIASI------QNAY-SYHLCGAIILDETWVLTAASC----------VAGL 98

  Fly    98 ---EFVLVMGSTYLTSSTDRTLMYY-LQQLITHENYNPDALTNDIALMFINGYIPWNWPTVTALA 158
               ..::|.|:   ....|....|| :.|:..|.|::.....|||||:.::..|.:|..|.....
  Fly    99 RPLNLLVVTGT---VDWWDLYAPYYTVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDVTKNITL 160

  Fly   159 LNSQLVATNTDCLISGWGLLQQNGTFSSNTLQAATVPIVSYTTCR---ISYNSIPVSQVCAGYLS 220
            .:...:........:|||..:..||: ...||.|:...:....||   .:.:.:.:..||. .:.
  Fly   161 ADIDELEEGDKLTFAGWGSSEAMGTY-GRYLQEASGTYLPVDACREKLQNQDDVDLGHVCV-QMD 223

  Fly   221 GGVDACQGDSGGPM-SCNGMLAGIVSYGAGCAAPGYPGVYTNVSYYYDWI 269
            .|..||.||:|||: .....|.||.::|..|.. |||.||...::|:|||
  Fly   224 AGQGACHGDTGGPLIDEQQRLVGIGNWGVPCGR-GYPDVYARTAFYHDWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 66/243 (27%)
Tryp_SPc 35..272 CDD:238113 68/244 (28%)
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 66/243 (27%)
Tryp_SPc 52..275 CDD:238113 68/244 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439383
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.