DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and CG4053

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster


Alignment Length:289 Identity:79/289 - (27%)
Similarity:136/289 - (47%) Gaps:50/289 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKVWAILAIALFLGA---LASGESLSSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSY 62
            ::.:|.:|     ||.   :..|:.|.:...  ::.:||||.:|......|||||       ::.
  Fly     5 LSLIWLLL-----LGTSIDVTRGKRLDNRKL--LDNRIVGGQEAEDGVAPYQVSI-------QTI 55

  Fly    63 GSGHLCGGVVISQRLVATAAHCCY---ITDKKKYRTAGEFVLVMGSTYLTSSTDR-----TLMYY 119
            ...|:|.||:::::.:.||.||..   |.|.:         :::|      :.||     ||  :
  Fly    56 WKTHICSGVILNEQWILTAGHCALDFSIEDLR---------IIVG------TNDRLEPGQTL--F 103

  Fly   120 LQQLITHENYN-PDALTNDIALMFINGYIPWNWPTVTALALNSQLVATNTDCLISGWGLLQQNGT 183
            ..:.:.|..|: |....|||||:.:|..|.:|..| ..:.|:.:.....:...::||| ..::..
  Fly   104 PDEALVHCLYDIPYVYNNDIALIHVNESIIFNDRT-QIVELSREQPPAGSTVTLTGWG-APESSY 166

  Fly   184 FSSNTLQAATVPIVSYTTCRIS---YNSIPVSQVCAGYLSGGVDACQGDSGGPMSCNGMLAGIVS 245
            .:...||...:.|:::..||..   ::.|.:..:|. :...|..||.||||||:...|.|.|:|:
  Fly   167 PTVQYLQTLNLTIIAHEECRERWDFHDGIDIGHICT-FTREGEGACSGDSGGPLMWEGKLVGLVN 230

  Fly   246 YGAGCAAPGYPGVYTNVSYYYDWIVQKNS 274
            :|..|.. |.|.:|.|..||.|||.:.:|
  Fly   231 WGRACGV-GMPDMYANTVYYQDWIRRTHS 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 70/246 (28%)
Tryp_SPc 35..272 CDD:238113 72/248 (29%)
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 70/246 (28%)
Tryp_SPc 35..256 CDD:238113 72/248 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.