DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and CG17475

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:251 Identity:87/251 - (34%)
Similarity:131/251 - (52%) Gaps:21/251 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ESLSSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCGGVVISQRLVATAAHCC 85
            |.:|.......:.:::.|.|..:.:..||:|:      :..|| ||:|||.:|.:|.|.|||||.
  Fly    36 EWISKAEGVNFQNRVINGEDVQLGEAKYQISL------QGMYG-GHICGGCIIDERHVLTAAHCV 93

  Fly    86 YITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHENYNPDALTNDIALMFINGYIPWN 150
            |     .|...  ::.|:..|......|  .:|::::...|.|||.....|||||:.:|..|.:|
  Fly    94 Y-----GYNPT--YLRVITGTVEYEKPD--AVYFVEEHWIHCNYNSPDYHNDIALIRLNDTIKFN 149

  Fly   151 WPTVTALALNSQLVATNTDCLISGWGLLQQNGTFSSNTLQAATVPIVSYTTCRISYNSIPVSQVC 215
            ..|..| .|.:..||..|..|::|||..:..|. :.:.||.|.:..|.|:||:...|:.|.:..|
  Fly   150 EYTQPA-ELPTAPVANGTQLLLTGWGSTELWGD-TPDILQKAYLTHVVYSTCQEIMNNDPSNGPC 212

  Fly   216 --AGYLSGGVDACQGDSGGPMSCNGMLAGIVSYGAGCAAPGYPGVYTNVSYYYDWI 269
              ....:||..||.||||||::.||:|.|:|::|..||. |.|..:.||.||.:||
  Fly   213 HICTLTTGGQGACHGDSGGPLTHNGVLYGLVNWGYPCAL-GVPDSHANVYYYLEWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 83/236 (35%)
Tryp_SPc 35..272 CDD:238113 85/237 (36%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 83/236 (35%)
Tryp_SPc 50..269 CDD:238113 85/237 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.