DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and CG17477

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster


Alignment Length:286 Identity:85/286 - (29%)
Similarity:128/286 - (44%) Gaps:32/286 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LAIALFLGALASGESLSSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCGGVV 72
            :::|.||..:....||..:... :|..||||.:|:.....||||::..      .|| |||||.:
  Fly     1 MSLARFLFYILVFSSLYCDLLA-LEHFIVGGQNAAEGDAPYQVSLQTL------LGS-HLCGGAI 57

  Fly    73 ISQRLVATAAHCCYITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHENYNPDALTND 137
            ||.|.:.||.||.     |.|.|:    .:..:|......:...:||...:..|.||:.....||
  Fly    58 ISDRWIITAGHCV-----KGYPTS----RLQVATGTIRYAEPGAVYYPDAIYLHCNYDSPKYQND 113

  Fly   138 IALMFINGYIPWNWPTVTALALNSQLVATNTDCLISGWGLLQQNGTFSSNTLQAATVPIVSYTTC 202
            |.|:.:|..|.:|..|.......|......::.:.:|||.....|:..|. ||......::...|
  Fly   114 IGLLHLNESITFNALTQAVELPTSPFPRGASELVFTGWGSQSAAGSLPSQ-LQRVQQQHLNSPAC 177

  Fly   203 R---ISYNSIPVS--QVCAGYLSGGVDACQGDSGGPMSCNGMLAGIVSYGAGCAAPGYPGVYTNV 262
            .   .:|..:.:.  .:|| |....:.||.||||||:...|.|.||:::...| |.|.|.::.|:
  Fly   178 ESMMSAYEDLELGPCHICA-YRQANIGACHGDSGGPLVHQGTLVGILNFFVPC-AQGVPDIFMNI 240

  Fly   263 SYYYDWIVQKNSSLNYTIYHNGGVRQ 288
            .||.||:.|       |:..||...|
  Fly   241 MYYRDWMRQ-------TMSGNGKCAQ 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 73/239 (31%)
Tryp_SPc 35..272 CDD:238113 74/241 (31%)
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 75/248 (30%)
Tryp_SPc 27..246 CDD:214473 72/237 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.