DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and CG10405

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster


Alignment Length:278 Identity:85/278 - (30%)
Similarity:130/278 - (46%) Gaps:37/278 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKVWAILAIALFLGALASGESLSSETAGKIEP--KIVGGYDASIEQVSYQVSIRLTANDKKSYG 63
            |.|..|.:...|..|.|...|:..:|.|...:|  :||.|.:|:..|..||:|:|..        
  Fly     1 MQKCRAPIPFLLIAGILVILEASRTEAAVPRQPDSRIVNGREATEGQFPYQLSLRRQ-------- 57

  Fly    64 SGHLCGGVVISQRLVATAAHCCYITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHEN 128
            :.|:||..::|.....|||||   .|..:.:.. ||.|..||...||.   ..:..::.:..|..
  Fly    58 TVHICGASILSSNWAITAAHC---IDGHEQQPR-EFTLRQGSIMRTSG---GTVQPVKAIYKHPA 115

  Fly   129 YNPDALTNDIALMF---------INGYIPWNWPTVTALALNSQLVATNTDCLISGWGLLQQNGTF 184
            |:...:..|:||:.         :....|...|||      .:.::.:...::||||.:..:...
  Fly   116 YDRADMNFDVALLRTADGALSLPLGKVAPIRLPTV------GEAISESMPAVVSGWGHMSTSNPV 174

  Fly   185 SSNTLQAATVPIVSYTTCRIS---YNSIPVSQVCAGYLSGGVDACQGDSGGPMSCNGMLAGIVSY 246
            .|:.|::.||..|:...|...   :..:..:..||.  :...||||||||||:|..|.|.||||:
  Fly   175 LSSVLKSTTVLTVNQEKCHNDLRHHGGVTEAMFCAA--ARNTDACQGDSGGPISAQGTLIGIVSW 237

  Fly   247 GAGCAAPGYPGVYTNVSY 264
            |.|||.|.||||||.:::
  Fly   238 GVGCADPYYPGVYTRLAH 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 75/243 (31%)
Tryp_SPc 35..272 CDD:238113 75/242 (31%)
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 75/243 (31%)
Tryp_SPc 37..263 CDD:238113 75/242 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.