DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and CG16749

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster


Alignment Length:278 Identity:94/278 - (33%)
Similarity:139/278 - (50%) Gaps:31/278 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LAIALFLGALASGESLSSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCGGVV 72
            |.:|:|.....:|.|..:...|    ::|.|.|:|:|:..:.:|:|      .|.|| |.|||.:
  Fly     7 LCLAVFALLTTAGISHGAPQMG----RVVNGTDSSVEKYPFVISMR------GSSGS-HSCGGSI 60

  Fly    73 ISQRLVATAAHCCYITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHENYNP-DALTN 136
            ||::.|.|||||   ||.:|   |.:..:..|.|.:.::....:.  ::::|.||:||| :...|
  Fly    61 ISKQFVMTAAHC---TDGRK---ASDLSVQYGVTKINATGPNVVR--VKKIIQHEDYNPYNNYAN 117

  Fly   137 DIALMFINGYIPWNWPTVTALALNSQLVAT-NTDC----LISGWGLLQQNGTFSSNTLQAATVPI 196
            ||:|:.:.....::..||..:.|.....|| .||.    ::.||| |...|.:..:|||...:.:
  Fly   118 DISLLLVEEPFEFDGVTVAPVKLPELAFATPQTDAGGEGVLIGWG-LNATGGYIQSTLQEVELKV 181

  Fly   197 VSYTTC--RISYNSIPVSQVCAGYLSGGVDACQGDSGGPMSCNGMLAGIVSYG-AGCAAPGYPGV 258
            .|...|  |....:.|...:|.|...||...|.||||||:..||...||||:. ..|....||||
  Fly   182 YSDEECTERHGGRTDPRYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGV 246

  Fly   259 YTNVSYYYDWIVQKNSSL 276
            |..||.|.|||  |.|.:
  Fly   247 YCKVSQYVDWI--KKSQI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 84/243 (35%)
Tryp_SPc 35..272 CDD:238113 86/245 (35%)
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 84/243 (35%)
Tryp_SPc 30..259 CDD:238113 86/246 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.