DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and CG12951

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster


Alignment Length:261 Identity:84/261 - (32%)
Similarity:127/261 - (48%) Gaps:32/261 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LSSETAGKIEP---KIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCGGVVISQRLVATAAHC 84
            |:..|.|:..|   ::|.|.|:|:.:..:.||:|       ||...|.|||.:||:..|.|||||
  Fly    15 LAVTTVGQAAPSISRVVNGTDSSVLKYPFVVSLR-------SYDGSHSCGGSIISKHFVMTAAHC 72

  Fly    85 CYITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHENYNPDAL-TNDIALMFINGYIP 148
                  ...|.|....:..|.|.:::.....:  .::::|.||:::|... .|||:|:.:.....
  Fly    73 ------TNGRPADTLSIQFGVTNISAMGPNVV--GIKKIIQHEDFDPTRQNANDISLLMVEEPFE 129

  Fly   149 WNWPTVTALALNSQLVA-----TNTDCLISGWGLLQQNGTFSS--NTLQAATVPIVSYTTCRISY 206
            ::..:|..:.|.:...|     ...:.::.||||   |.|:.|  :|||..::.|.|...|...:
  Fly   130 FDGVSVAPVELPALAFAVPQSDAGVEGVLIGWGL---NDTYGSVQDTLQEVSLKIYSDEECTSRH 191

  Fly   207 N--SIPVSQVCAGYLSGGVDACQGDSGGPMSCNGMLAGIVSYG-AGCAAPGYPGVYTNVSYYYDW 268
            |  :.|...:|.|...||...|.||||||:..||...||||:. ..|....|||||..||.|.||
  Fly   192 NGQTDPKYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDW 256

  Fly   269 I 269
            |
  Fly   257 I 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 78/245 (32%)
Tryp_SPc 35..272 CDD:238113 80/246 (33%)
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 78/245 (32%)
Tryp_SPc 30..260 CDD:238113 80/246 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.