DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and Tmprss11c

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001003979.1 Gene:Tmprss11c / 408213 RGDID:1302967 Length:418 Species:Rattus norvegicus


Alignment Length:299 Identity:96/299 - (32%)
Similarity:144/299 - (48%) Gaps:56/299 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KVWAILAIALFLGALASGESLSSET-------------AGK--IEP---KIVGGYDASIEQVSYQ 49
            |.|..:...|:       :.|.|:|             .|:  |.|   |:.||.||...:..:|
  Rat   144 KFWDSVETILY-------QKLKSQTRLLIDSSSFKFSGCGRRTITPGGHKVAGGQDAEEGEWPWQ 201

  Fly    50 VSIRLTANDKKSYGSGHLCGGVVISQRLVATAAHCCYI--TDKKKYRTAGEFVLVMGSTYLTSST 112
            .|::        ..:.|.||..:||...:.|||| |::  .:.|.::.:..|:|          :
  Rat   202 ASLQ--------QNNVHRCGATLISNSWLITAAH-CFVRSANPKDWKVSFGFLL----------S 247

  Fly   113 DRTLMYYLQQLITHENYNPDALTNDIALMFINGYIPW-NWPTVTALALNSQLVATNTDCLISGWG 176
            .......::.::.||||:..|..||||::.::..:.: |......|...:|....|:|.:::|||
  Rat   248 KPQAQRAVKSIVIHENYSYPAHNNDIAVVRLSSPVLYENNIRRACLPEATQKFPPNSDVVVTGWG 312

  Fly   177 LLQQNGTFSSNTLQAATVPIVSYTTCRI--SYNS-IPVSQVCAGYLSGGVDACQGDSGGPM---S 235
            .|:.:|. |.|.||...|.|:...||..  :|.. |....:|||:|.|.|||||||||||:   .
  Rat   313 TLKSDGD-SPNILQKGRVKIIDNKTCNSGKAYGGVITPGMLCAGFLEGRVDACQGDSGGPLVSED 376

  Fly   236 CNGM--LAGIVSYGAGCAAPGYPGVYTNVSYYYDWIVQK 272
            ..|:  ||||||:|..||.|..|||||.|::|.|||..|
  Rat   377 SKGIWFLAGIVSWGDECALPNKPGVYTRVTHYRDWISSK 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 84/245 (34%)
Tryp_SPc 35..272 CDD:238113 85/247 (34%)
Tmprss11cNP_001003979.1 SEA 62..157 CDD:279699 3/19 (16%)
Tryp_SPc 186..412 CDD:214473 84/245 (34%)
Tryp_SPc 187..415 CDD:238113 85/247 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.