DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and CG10587

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001137989.2 Gene:CG10587 / 40318 FlyBaseID:FBgn0037039 Length:289 Species:Drosophila melanogaster


Alignment Length:298 Identity:83/298 - (27%)
Similarity:134/298 - (44%) Gaps:54/298 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILAIALFLGALASGESLSSETAGKI--------------EPKIVGGYDASIEQV-SYQVSIRLTA 56
            :|...|....|||.|.|:.:....|              :.::|||...:..|: .|.:::|   
  Fly     4 LLLYCLLTAPLASIEVLAQDLNQTIDVNKLAKIVQRPGFQTRVVGGDVTTNAQLGGYLIALR--- 65

  Fly    57 NDKKSYGSGHLCGGVVISQRLVATAAHCCYITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQ 121
                 |....:|||.::...:|.|||| |::...|    ..:::.|.|::.|   .||.:...::
  Fly    66 -----YEMNFVCGGTLLHDLIVLTAAH-CFLGRVK----ISDWLAVGGASKL---NDRGIQRQVK 117

  Fly   122 QLITHENYNPDALTNDIALMFINGYIPWNWPTVTALALNSQLVATNTDCLISGWGLLQQNGTFSS 186
            ::|....:..|.:..|:|::.:..  |....::..|.|..:.:...|:..:|||||.:.:.....
  Fly   118 EVIKSAEFREDDMNMDVAILRLKK--PMKGKSLGQLILCKKQLMPGTELRVSGWGLTENSEFGPQ 180

  Fly   187 NTLQAATVPIVSYTTCRISYNSIPV------------------SQVCAGYLSGGVDACQGDSGGP 233
            ..|:..|||:|....||.||  :|.                  |..|||.| |..|||..|||||
  Fly   181 KLLRTVTVPVVDKKKCRASY--LPTDWESHKHFDLFLKVHLTDSMFCAGVL-GKKDACTFDSGGP 242

  Fly   234 MSCNGMLAGIVSYGAGCAAPGYPGVYTNVSYYYDWIVQ 271
            :.....:.||||:|.|||:..|.||||::.|...:|.|
  Fly   243 LVYKNQVCGIVSFGIGCASKRYYGVYTDIMYVKPFIEQ 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 73/253 (29%)
Tryp_SPc 35..272 CDD:238113 75/256 (29%)
CG10587NP_001137989.2 Tryp_SPc 45..278 CDD:214473 73/253 (29%)
Tryp_SPc 46..280 CDD:238113 74/254 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.