DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and CG11037

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_649272.1 Gene:CG11037 / 40317 FlyBaseID:FBgn0037038 Length:292 Species:Drosophila melanogaster


Alignment Length:275 Identity:80/275 - (29%)
Similarity:133/275 - (48%) Gaps:43/275 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GESLSSETA--GKI------EPKIVGGYDASIEQVSYQVSIRLTANDKKS-------YGSGHLCG 69
            |::|:.:.|  .||      |.:::||:              :|.|.|..       |....:||
  Fly    39 GKNLTLDVAQLAKIVLPSPHETRVIGGH--------------VTTNAKLGGYLTALLYEDDFVCG 89

  Fly    70 GVVISQRLVATAAHCCYITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHENYNPDAL 134
            |.::::.:|.|||| |::...|    |.|:::..|   :::...:.:..:::..|..|.:..|.:
  Fly    90 GTLLNENIVLTAAH-CFLGRMK----ASEWIVAAG---ISNLNQKGIRRHVKDFILSEQFREDDM 146

  Fly   135 TNDIALMFINGYIPWNWPTVTALALNSQLVATNTDCLISGWGLLQQNGTFSSNTLQAATVPIVSY 199
            ..|:|::.:.  .|.....:..|:|.|..:....:.::||||:....|....|.|:..||||:..
  Fly   147 NMDVAVVLLK--TPLKAKNIGTLSLCSVSLKPGVELVVSGWGMTAPRGRGPHNLLRTVTVPIIHK 209

  Fly   200 TTCRISYN---SIPVSQVCAGYLSGGVDACQGDSGGPMSCNGMLAGIVSYGAGCAAPGYPGVYTN 261
            ..||.:|.   .|..|.:||..| |..|||..|||||:.....:.||||:|.|||:..||||||:
  Fly   210 KNCRAAYQPTAKITDSMICAAVL-GRKDACTFDSGGPLVFKKQVCGIVSFGIGCASNRYPGVYTD 273

  Fly   262 VSYYYDWIVQKNSSL 276
            |.|...:|.:...:|
  Fly   274 VMYVKPFIEKSIKAL 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 72/244 (30%)
Tryp_SPc 35..272 CDD:238113 73/246 (30%)
CG11037NP_649272.1 Tryp_SPc 61..281 CDD:214473 72/244 (30%)
Tryp_SPc 62..283 CDD:238113 73/245 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455656
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.