DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and Sems

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster


Alignment Length:287 Identity:80/287 - (27%)
Similarity:130/287 - (45%) Gaps:47/287 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILAIALFLG------ALASGESLSSETAGKI------EPKIVGGYDASIEQVSYQVSIRLTANDK 59
            :|.:.|..|      ||...|::..:...||      :.:::||              |:|.|.|
  Fly     4 LLFLFLLAGILINNHALQHNETIDLKKLAKIVLPPAYQTRVIGG--------------RVTTNAK 54

  Fly    60 -------KSYGSGHLCGGVVISQRLVATAAHCCYITDKKKYRTAGEFVLVMGSTYLTSSTDRTLM 117
                   ..|.:..:|||.:|.:.:|.|||||.      :.|...|...|.|.  ::..:::.:.
  Fly    55 LGGYLVAMRYFNNFICGGTLIHELIVLTAAHCF------EDRAEKEAWSVDGG--ISRLSEKGIR 111

  Fly   118 YYLQQLITHENYNPDALTNDIALMFINGYIPWNWPTVTALALNSQLVATNTDCLISGWGLLQQNG 182
            ..:::.|....:....:..|:|::.:|.  |.....:..|:|.|..:.......:||||:...:.
  Fly   112 RQVKRFIKSAQFKMVTMNMDVAVVLLNR--PMVGKNIGTLSLCSTALTPGQTMDVSGWGMTNPDD 174

  Fly   183 TFSSNTLQAATVPIVSYTTCRISYN---SIPVSQVCAGYLSGGVDACQGDSGGPMSCNGMLAGIV 244
            ....:.|:..:||::....||.:|.   ||..|..||..| |..|||..|||||:.....:.|||
  Fly   175 EGPGHMLRTVSVPVIEKRICREAYRESVSISDSMFCASVL-GKKDACTYDSGGPLVYEKQVCGIV 238

  Fly   245 SYGAGCAAPGYPGVYTNVSYYYDWIVQ 271
            |:|.|||:..||||||:|.|...:||:
  Fly   239 SFGIGCASRRYPGVYTDVHYVKPFIVK 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 70/244 (29%)
Tryp_SPc 35..272 CDD:238113 72/247 (29%)
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 70/244 (29%)
Tryp_SPc 44..265 CDD:238113 71/245 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455672
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.