DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and CG10663

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster


Alignment Length:274 Identity:83/274 - (30%)
Similarity:124/274 - (45%) Gaps:37/274 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IALFLGALASG---ESLSSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCGGV 71
            :.|..|.:.||   .|:|:..      ||:||..|...:..:||:|  ....|:::     |||.
  Fly   485 LKLSCGIVRSGTGRRSMSNML------KIIGGRAARKGEWPWQVAI--LNRFKEAF-----CGGT 536

  Fly    72 VISQRLVATAAHCCYITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHENYNPDALTN 136
            :|:.|.|.|||||.     :|..    ||.: |...|.......:...:.:..||.|::...:.:
  Fly   537 LIAPRWVLTAAHCV-----RKVL----FVRI-GEHNLNYEDGTEIQLRVMKSYTHPNFDKRTVDS 591

  Fly   137 DIALMFINGYI-PWNWPTVTALALNSQLVATNTDCLISGWGLLQQNGTFSSNTLQAATVPIVSYT 200
            |:||:.:...: ...|...:.|....|.:..|.||.|.|||..:......::.|..|||||:...
  Fly   592 DVALLRLPKAVNATTWIGYSCLPQPFQALPKNVDCTIIGWGKRRNRDATGTSVLHKATVPIIPMQ 656

  Fly   201 TCRISY--NSIPVSQVCAGYLSGGVDACQGDSGGPMSCNG--------MLAGIVSYGAGCAAPGY 255
            .||..|  .:|..:..|||:..|.:|.|.||||||:.|..        .:.||.|:|.|||....
  Fly   657 NCRKVYYDYTITKNMFCAGHQKGHIDTCAGDSGGPLLCRDTTKPNHPWTIFGITSFGDGCAQRNK 721

  Fly   256 PGVYTNVSYYYDWI 269
            .|:|..|..|.||:
  Fly   722 FGIYAKVPNYVDWV 735

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 76/245 (31%)
Tryp_SPc 35..272 CDD:238113 76/246 (31%)
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 76/245 (31%)
Tryp_SPc 507..735 CDD:238113 75/244 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455717
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.