DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and TMPRSS11F

DIOPT Version :10

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_997290.2 Gene:TMPRSS11F / 389208 HGNCID:29994 Length:438 Species:Homo sapiens


Alignment Length:248 Identity:81/248 - (32%)
Similarity:129/248 - (52%) Gaps:26/248 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KIVGGYDASIE-QVSYQVSIRLTANDKKSYGSGHLCGGVVISQRLVATAAHCCYITDKKKYRTAG 97
            :||.|.:.::| :..:|.|::|       .||||.||..:||...:.|||||.:     |.:...
Human   205 RIVQGRETAMEGEWPWQASLQL-------IGSGHQCGASLISNTWLLTAAHCFW-----KNKDPT 257

  Fly    98 EFVLVMGSTYLTSSTDRTLMYYLQQLITHENYNPDALTNDIALMFINGYIPW-NWPTVTALALNS 161
            :::...|:|....:..|.    ::::|.||||:.:...|||||:.::..:.: |......|..:|
Human   258 QWIATFGATITPPAVKRN----VRKIILHENYHRETNENDIALVQLSTGVEFSNIVQRVCLPDSS 318

  Fly   162 QLVATNTDCLISGWGLLQQNGTFSSNTLQAATVPIVSYTTCR---ISYNSIPVSQVCAGYLSGGV 223
            ..:...|...::|:|.:..:|.. .|||:.|.|..:|...|.   :....|....:|||::.|.:
Human   319 IKLPPKTSVFVTGFGSIVDDGPI-QNTLRQARVETISTDVCNRKDVYDGLITPGMLCAGFMEGKI 382

  Fly   224 DACQGDSGGPMSCNG----MLAGIVSYGAGCAAPGYPGVYTNVSYYYDWIVQK 272
            |||:||||||:..:.    .:.||||:|..||.|..|||||.|:.|.|||..|
Human   383 DACKGDSGGPLVYDNHDIWYIVGIVSWGQSCALPKKPGVYTRVTKYRDWIASK 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 78/243 (32%)
TMPRSS11FNP_997290.2 SEA 59..158 CDD:460188
Tryp_SPc 206..435 CDD:238113 80/245 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.