DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and CG32271

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster


Alignment Length:265 Identity:85/265 - (32%)
Similarity:128/265 - (48%) Gaps:33/265 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKVWAILAIALFLGALASGESLSSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSG 65
            ||.:|.:|.:.....| ||.|:.|         :||||....|..|.|.|::|:        |..
  Fly     1 MATLWLVLHLIPLCWA-ASNEANS---------RIVGGVPVDIASVPYLVNLRI--------GGN 47

  Fly    66 HLCGGVVISQRLVATAAHCCYITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHENYN 130
            .:|||.:::.:.|.|||||.      |...|...::|.|.|.||.:..|:   .:.::.|.:.||
  Fly    48 FMCGGSLVTPQHVVTAAHCV------KGIGASRILVVAGVTRLTETGVRS---GVDKVYTPKAYN 103

  Fly   131 PDALTNDIALMFINGYIPWNWPTVTALALNSQLVATNTDCLISGWGLLQQNGTFSSNTLQAATVP 195
            ...||:|:|::.:..  |.:.|.|:.:.|.:..........:||||.:.:.....|..:::..|.
  Fly   104 TRTLTSDVAVLKLKA--PISGPKVSTIELCNTSFKAGDLIKVSGWGQITERNKAVSMQVRSVDVA 166

  Fly   196 IVSYTTCRISY---NSIPVSQVCAGYLSGGVDACQGDSGGPMSCNGMLAGIVSYGAGCAAPGYPG 257
            ::....|...|   .:|..:..||. :.|..|||:||||||....|.|.||||:|.|||....||
  Fly   167 LIPRKACMSQYKLRGTITNTMFCAS-VPGVKDACEGDSGGPAVYQGQLCGIVSWGVGCARKSSPG 230

  Fly   258 VYTNV 262
            |||||
  Fly   231 VYTNV 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 76/232 (33%)
Tryp_SPc 35..272 CDD:238113 76/231 (33%)
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 76/232 (33%)
Tryp_SPc 25..244 CDD:238113 76/231 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455680
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.