DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and CG13527

DIOPT Version :10

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster


Alignment Length:64 Identity:15/64 - (23%)
Similarity:26/64 - (40%) Gaps:10/64 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 RYGMKTENLKL-------YMRRFITVLFTIFLINHTVRIFFHRIEEVTDNDMKV---RELGIPC 126
            |:..:.|.|:|       |.......|:.:.|.:...|:||..|.|..:..|.:   ..:|:.|
  Fly    94 RFKSQEEQLELCRISISRYQEDLNKYLYLVDLQDRNERLFFRLISEDVEKMMPIVYTPTVGLAC 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 15/64 (23%)
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 15/64 (23%)

Return to query results.
Submit another query.