DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and Ser8

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster


Alignment Length:282 Identity:93/282 - (32%)
Similarity:135/282 - (47%) Gaps:37/282 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LAIALFLG--ALASG-------ESLSSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYG 63
            |.||.||.  ||.:|       |..:|...|    :||||..:|||...:|||::.:.:      
  Fly     3 LLIATFLALLALTNGAVIPIGLEPQTSSLGG----RIVGGTASSIEDRPWQVSLQRSGS------ 57

  Fly    64 SGHLCGGVVISQRLVATAAHCCYITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHEN 128
              |.|||.:||..::.|||||.     ....|.....:..||   ...|...::..:..:..||.
  Fly    58 --HFCGGSIISNNIIVTAAHCL-----DTPTTVSNLRIRAGS---NKRTYGGVLVEVAAIKAHEA 112

  Fly   129 YNPDALTNDIALMFINGYIPWNWPTVTALALNSQLVATNTDCLISGWGLLQQNGTFSSNTLQAAT 193
            ||.::..|||.::.:...:.:. .|:.|:.:.|...|..:...|||||....:|. ||.||....
  Fly   113 YNSNSKINDIGVVRLKTKLTFG-STIKAITMASATPAHGSAASISGWGKTSTDGP-SSATLLFVD 175

  Fly   194 VPIVSYTTCRIS---YNS-IPVSQVCAGYLSGGVDACQGDSGGPMSCNGMLAGIVSYGAGCAAPG 254
            ..||..:.|..|   |.| |..:.:||.  :...||||||||||:...|.|.|:||:|..||...
  Fly   176 TRIVGRSQCGSSTYGYGSFIKATMICAA--ATNKDACQGDSGGPLVSGGQLVGVVSWGRDCAVAN 238

  Fly   255 YPGVYTNVSYYYDWIVQKNSSL 276
            |||||.|::...||::|...::
  Fly   239 YPGVYANIAELRDWVLQAQKTV 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 80/238 (34%)
Tryp_SPc 35..272 CDD:238113 81/240 (34%)
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 80/238 (34%)
Tryp_SPc 35..253 CDD:238113 80/237 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.