DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and Prss3

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001102096.1 Gene:Prss3 / 362347 RGDID:1311446 Length:246 Species:Rattus norvegicus


Alignment Length:248 Identity:95/248 - (38%)
Similarity:124/248 - (50%) Gaps:39/248 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 EPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSG-HLCGGVVISQRLVATAAHCCYITDKKKYRT 95
            :.||||||......|.||||:          .|| |.|||.:|:.:.|.:||||        |:|
  Rat    21 DDKIVGGYTCQENSVPYQVSL----------NSGYHFCGGSLINDQWVVSAAHC--------YKT 67

  Fly    96 -----AGEF---VLVMGSTYLTSSTDRTLMYYLQQLITHENYNPDALTNDIALMFINGYIPWNWP 152
                 .||.   ||.....::.::          ::|.|.|:|...|.|||.|:.::..:..| .
  Rat    68 RIQVRLGEHNINVLEGDEQFVNAA----------KIIKHPNFNARNLNNDIMLIKLSSPVKLN-A 121

  Fly   153 TVTALALNSQLVATNTDCLISGWGLLQQNGTFSSNTLQAATVPIVSYTTCRISY-NSIPVSQVCA 216
            .|..:||.|......|.|||||||.....|..:.:.||....|::....|..|| ..|..:.:|.
  Rat   122 RVATVALPSSCAPAGTQCLISGWGNTLSLGVNNPDLLQCLDAPVLPQADCEASYPGKITNNMICV 186

  Fly   217 GYLSGGVDACQGDSGGPMSCNGMLAGIVSYGAGCAAPGYPGVYTNVSYYYDWI 269
            |:|.||.|:||||||||:.|||.|.||||:|.|||....|||||.|..|.|||
  Rat   187 GFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALKDNPGVYTKVCNYVDWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 93/244 (38%)
Tryp_SPc 35..272 CDD:238113 94/245 (38%)
Prss3NP_001102096.1 Tryp_SPc 23..239 CDD:214473 93/244 (38%)
Tryp_SPc 24..242 CDD:238113 94/245 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.