DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and thetaTry

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster


Alignment Length:288 Identity:85/288 - (29%)
Similarity:138/288 - (47%) Gaps:49/288 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILAIALFLGALASGE-SLSSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCGG 70
            :|.:.|.:|:..:|. .:|:....:.|.:||||.|.:|....||||::..:      || |.|||
  Fly     6 VLLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKS------GS-HFCGG 63

  Fly    71 VVISQRLVATAAHCCYITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHENYNPDALT 135
            .:|::..|.|||||..      .|...:..:.:|||..   .:..::..:::|..:|:||...:.
  Fly    64 SLINEDTVVTAAHCLV------GRKVSKVFVRLGSTLY---NEGGIVVAVRELAYNEDYNSKTME 119

  Fly   136 NDIALMFINGYIPWNWPTVTALALNSQLVATNTDCLISGWGLLQQNGTFSS---------NTLQA 191
            .|:.::.::..:. ....:..:.|.::...|.|..:::|||        |.         .|||.
  Fly   120 YDVGILKLDEKVK-ETENIRYIELATETPPTGTTAVVTGWG--------SKCYFWCMTLPKTLQE 175

  Fly   192 ATVPIVSYTTC--------RISYNSIPVSQVCAGYLSGGVDACQGDSGGPMSCNGMLAGIVSYGA 248
            ..|.||.:.||        .|.|:|:    |||  .....||||||||||::....|.||||:|.
  Fly   176 VYVNIVDWKTCASDEYKYGEIIYDSM----VCA--YEKKKDACQGDSGGPLAVGNTLVGIVSWGY 234

  Fly   249 GCAAPGYPGVYTNVSYYYDWIVQKNSSL 276
            .||:...||||::|.....||:..:.:|
  Fly   235 ACASNLLPGVYSDVPALRKWILNASETL 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 76/251 (30%)
Tryp_SPc 35..272 CDD:238113 78/253 (31%)
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 76/251 (30%)
Tryp_SPc 35..255 CDD:238113 76/250 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27101
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.