DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and etaTry

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster


Alignment Length:272 Identity:108/272 - (39%)
Similarity:152/272 - (55%) Gaps:22/272 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILAIALFLGALASGESLSSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCGGV 71
            |||:...||..|    :|:::.|    :||||.|.|.....|.|.:|..::...||  ...|||.
  Fly     8 ILAVLFLLGIYA----VSAQSDG----RIVGGADTSSYYTKYVVQLRRRSSSSSSY--AQTCGGC 62

  Fly    72 VISQRLVATAAHCCYITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHENYNPDALTN 136
            ::....:||||||.|      .|.|..|::|.|..  :......::..:.:||.||.||...:.|
  Fly    63 ILDAVTIATAAHCVY------NREAENFLVVAGDD--SRGGMNGVVVRVSKLIPHELYNSSTMDN 119

  Fly   137 DIALMFINGYIPW-NWPTVTALALNSQLVATNTDCLISGWGLLQQNGTFSSNTLQAATVPIVSYT 200
            ||||:.::..:|. ::.|:.|:.:.|:..|......|||||..::|| .||:.||...||||...
  Fly   120 DIALVVVDPPLPLDSFSTMEAIEIASEQPAVGVQATISGWGYTKENG-LSSDQLQQVKVPIVDSE 183

  Fly   201 TCRISYNSIPVSQ--VCAGYLSGGVDACQGDSGGPMSCNGMLAGIVSYGAGCAAPGYPGVYTNVS 263
            .|:.:|...|:|:  :|||...||.||||||||||:.....||||||:|.|||.|.|||||.||:
  Fly   184 KCQEAYYWRPISEGMLCAGLSEGGKDACQGDSGGPLVVANKLAGIVSWGEGCARPNYPGVYANVA 248

  Fly   264 YYYDWIVQKNSS 275
            ||.|||.::.:|
  Fly   249 YYKDWIAKQRTS 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 97/237 (41%)
Tryp_SPc 35..272 CDD:238113 99/239 (41%)
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 97/237 (41%)
Tryp_SPc 28..257 CDD:238113 99/239 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455576
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.