DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and CG17571

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster


Alignment Length:252 Identity:92/252 - (36%)
Similarity:125/252 - (49%) Gaps:32/252 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCGGVVISQRLVATAAHCCYITDKKKYRTAGE 98
            :||.|.|..||...||||::.|.      || |.|||.:|....|.|||||     .:.| .|.|
  Fly    30 RIVNGEDVDIENYPYQVSVQTTK------GS-HFCGGSLIDSETVLTAAHC-----MQSY-AASE 81

  Fly    99 FVLVMGSTYLTSS----TDRTLMYYLQQLITHENYNPDALTNDIALMFINGYIPWNWPTVTALAL 159
            ..:.:|||..:|.    |.|...|       ||.||...:.||:|::.::..:. ....:.|:.|
  Fly    82 LQVRVGSTSRSSGGEVVTVRAFKY-------HEGYNSKLMINDVAIIKLSSPVR-QTSKIRAIEL 138

  Fly   160 NSQLVATNTDCLISGWGLLQQNGTFSSNTLQAATVPIVSYTTCRI-SYN----SIPVSQVCAGYL 219
            ......:.|:.::||||........|.:|||...|.::.|..|.. :||    ||..:.|||  .
  Fly   139 ADSEAVSGTNAVVSGWGTTCFLFCSSPDTLQKVEVDLLHYKDCAADTYNYGSDSILETMVCA--T 201

  Fly   220 SGGVDACQGDSGGPMSCNGMLAGIVSYGAGCAAPGYPGVYTNVSYYYDWIVQKNSSL 276
            ....||||||||||:..:..|.|:||:|:|||..||||||.:|:....|||....||
  Fly   202 GEKKDACQGDSGGPLVADNKLVGVVSWGSGCAWTGYPGVYADVASLRSWIVDTTDSL 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 87/243 (36%)
Tryp_SPc 35..272 CDD:238113 90/245 (37%)
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 87/243 (36%)
Tryp_SPc 31..254 CDD:238113 90/245 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.