DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and Phae1

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster


Alignment Length:278 Identity:84/278 - (30%)
Similarity:128/278 - (46%) Gaps:48/278 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ALASGESL-------SSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCGGVVI 73
            :||||..|       |....|..|.::|||..|::....|.||::        ||..|.|...::
  Fly    10 SLASGLLLLLGICRISGVAIGAPEGRVVGGSPAAVNSAPYAVSMQ--------YGGTHYCAASIL 66

  Fly    74 SQRLVATAAHCCYITDKKKYRTAGEFVLVMGSTYL--------TSST--DRTLMYYLQQLITHEN 128
            :...:.|||||  :|:..:         |:|||.:        |:||  .|::.|:    :.::.
  Fly    67 NANWLVTAAHC--LTNSNQ---------VLGSTLVAGSIAVDGTASTTQTRSITYF----VINDL 116

  Fly   129 YNPDALTNDIALMFINGYIPWNWPTVTALALNSQLVATNTDCLISGWGLLQQNGTFS-SNTLQAA 192
            |....:..||.:::......|:.........:|.:|.|.|..|. |||......|.| .:|||.|
  Fly   117 YTGGTVPYDIGMIYTPTAFVWSAAVAPVTLPSSGVVPTGTANLY-GWGSTSTTNTASYPSTLQVA 180

  Fly   193 T-VPIVSYTTCRISY----NSIPVSQVCAGYLSGGVDACQGDSGGPMSCNGMLAGIVSYG-AGCA 251
            | |||:|.::|..:.    :.:..:.:|.|.|:|||..|..|||||:....:|.||||:| ..|.
  Fly   181 TNVPIISLSSCESALGTKGSDVHSTNLCTGPLTGGVSICTSDSGGPLVQGNVLIGIVSWGKLPCG 245

  Fly   252 APGYPGVYTNVSYYYDWI 269
            ....|.||..||.:..||
  Fly   246 QANSPSVYVQVSSFISWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 74/251 (29%)
Tryp_SPc 35..272 CDD:238113 76/252 (30%)
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 74/251 (29%)
Tryp_SPc 36..266 CDD:238113 76/252 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455594
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.