DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and Try29F

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster


Alignment Length:288 Identity:103/288 - (35%)
Similarity:149/288 - (51%) Gaps:55/288 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAK------VWAILAIALFLGALASGESLSSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDK 59
            |||      :..||.:.|.|||        :....:::.:||||..|:|:.:.||||:      :
  Fly    10 MAKTILHLFIGGILLVNLSLGA--------TVRRPRLDGRIVGGQVANIKDIPYQVSL------Q 60

  Fly    60 KSYGSGHLCGGVVISQRLVATAAHCCYITDKKKYRTAGEFVLV----MGSTYLTSSTDRT----L 116
            :||   |.|||.:|:|..|.|||||          |.|..:|:    :||:       ||    .
  Fly    61 RSY---HFCGGSLIAQGWVLTAAHC----------TEGSAILLSKVRIGSS-------RTSVGGQ 105

  Fly   117 MYYLQQLITHENYNPDALTNDIALMFINGYIPWNWPTVTALALNSQ--LVATNTDCLISGWGLLQ 179
            :..::::..|..::...:..|.:|:.:..|...| .|...:.|..|  .:|..|..|:|||| ..
  Fly   106 LVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKN-VTQAFVGLPEQDADIADGTPVLVSGWG-NT 168

  Fly   180 QNGTFSSNTLQAATVPIVSYTTCRISY---NSIPVSQVCAGYLSGGVDACQGDSGGPMSCNGMLA 241
            |:...:|..|::.|||.||.|.|..:|   .||....:|||...||.||||||||||::.:|:|.
  Fly   169 QSAQETSAVLRSVTVPKVSQTQCTEAYGNFGSITDRMLCAGLPEGGKDACQGDSGGPLAADGVLW 233

  Fly   242 GIVSYGAGCAAPGYPGVYTNVSYYYDWI 269
            |:||:|.|||.|.|||||:.||...|||
  Fly   234 GVVSWGYGCARPNYPGVYSRVSAVRDWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 92/247 (37%)
Tryp_SPc 35..272 CDD:238113 94/248 (38%)
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 92/247 (37%)
Tryp_SPc 42..264 CDD:238113 94/248 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.